Prodotti biochimici e reagenti

<p>Streptococcus Pneumoniae antibody was raised in mouse using the Streptococcus pneumoniae common C-polysaccharide as the immunogen.</p>

<p>HCG protein is a recombinant protein that plays a crucial role in various immunological processes. It acts as an antigen, initiating an antigen-antibody reaction, and is involved in the production of immunoglobulin molecules. HCG protein is widely used in the field of life sciences for research purposes, particularly in studies related to leukocyte antigens and circumsporozoite proteins. It also exhibits growth factor properties and has been shown to stimulate cell proliferation and differentiation. Additionally, HCG protein has antiviral activity and can induce interferon production. Its cytotoxic effects make it a potential candidate for targeted cancer therapies. With its diverse range of applications, HCG protein is an essential tool for scientists and researchers in the field of molecular biology and immunology.</p>

<p>Peptide Ac-CCLLMPPPPPLFPPPFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HSV-2 IgM Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about HSV-2 IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>PGS1 antibody was raised using the C terminal of PGS1 corresponding to a region with amino acids QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP</p>

<p>Mumps IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Mumps IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-LGEVNTYAGDLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NTDGSTDYGILQINSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Inhibits RNAPII-mediated trasncription; immunosuppressant; anti-inflammatory</p>

<p>C-myc antibody was raised in mouse using recombinant c-myc protein as the immunogen.</p>

<p>Peptide Ac-KIFMK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>beta Actin antibody was raised in mouse using beta-Actin N-terminal peptide-KLH conjugates as the immunogen.</p>

<p>The PfHRPII antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed for hybridization experiments and is commonly used in research laboratories. This antibody is highly specific and has been extensively tested for its effectiveness.</p>

<p>Sterile Filtered Calf Serum</p>

<p>H-ENFAGEATLQR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ENFAGEATLQR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ENFAGEATLQR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ENFAGEATLQR-OH at the technical inquiry form on this page</p>

<p>Purified Mouse anti-His6-Tag Antibody</p>

<p>Roflumilast is a selective phosphodiesterase-4 inhibitor that is used for the treatment of exacerbations in patients with chronic obstructive pulmonary disease (COPD). It is also used to treat plaque psoriasis. This drug has anti-inflammatory and immunomodulatory effects as it aids in increasing levels of cAMP.</p>

<p>CA 125 antibody was raised in mouse using purified human ovarian mucin antigen from ascites as the immunogen.</p>

<p>Peptide H-SGTLGHPGSLDETTYER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Elastase antibody was raised in mouse using purified human neutrophil elastase as the immunogen.</p>

<p>Ac-NELKRSFFALRDQI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-NELKRSFFALRDQI-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-NELKRSFFALRDQI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-NELKRSFFALRDQI-OH at the technical inquiry form on this page</p>

<p>Peptide H-FTFSLDTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GV^YDGEEHSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Troponin I antibody (skeletal Muscle) was raised in mouse using human skTnI as the immunogen.</p>

<p>H-STQAAIDQINGK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-STQAAIDQINGK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-STQAAIDQINGK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-STQAAIDQINGK-OH at the technical inquiry form on this page</p>

<p>H-Asp(Lys-OH)-OH is a metabolite that is an intermediate in the fatty acid oxidation pathway. It may be involved in the progression of colorectal carcinoma by inhibition of fatty acid synthesis, leading to the accumulation of fatty acids and subsequent death. This metabolite can also be used to identify potential biomarkers for colorectal cancer. H-Asp(Lys-OH)-OH can be detected using liquid chromatography coupled with mass spectrometry (LC/MS).</p>

<p>ApoA-II antibody was raised in goat using human apolipoprotein A-II as the immunogen.</p>

<p>Peptide H-LTIGEGQQHHLGGA^K^QA^GDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>DPP-4 enzyme inhibitor; anti-diabetic</p>

<p>Peptide H-ELINNELSHFLEEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DRVYIHP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Potent and irreversible inhibitor of phosphoinositide-3-kinase (PtdIns-3-kinase) with IC50 of 0.1 nM. PX 866 inhibited cell motility and growth of 3D spheroids of glioblastoma, breast, prostate and colon cancer cell lines at low nanomolar concentrations. PX 866 also exhibited anti-tumoral activity in vivo in xenograft models for ovarian and lung cancer.</p>

<p>The PRG2 antibody is a valuable tool in the field of Life Sciences. It is an antibody that specifically targets and binds to mesenchymal stem cells in human serum. This antibody has shown reactivity towards autoantibodies, making it ideal for research involving autoimmune diseases. The PRG2 antibody can be used in various applications, including electrochemical impedance spectroscopy, ultrasensitive detection, and immobilization on electrodes. Its high specificity and sensitivity allow for accurate and reliable results in experiments involving fibrinogen, carbamazepine, and protein carbonyls. Whether you are studying stem cell biology or investigating autoimmune disorders, the PRG2 antibody is an essential component of your research toolkit.</p>

<p>Naftopidil is an alpha adrenergic antagonist drug that is used to treat urinary symptoms and conditions related to benign prostatic hypertrophy. This drug works to relax smooth muscles by inhibiting alpha adrenergic receptors, thus allowing an improvement in urine flow.</p>

<p>Peptide H-CRPKPQQFFGLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Apo (a) antibody was raised in goat using human apolipoprotein (a) as the immunogen.</p>

<p>Peptide H-FQTFEGDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NAVEVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Streptolysin O protein is a monoclonal antibody that belongs to the category of Recombinant Proteins &amp; Antigens. It is designed to target specific molecules and has been found to be effective in neutralizing autoantibodies. Streptolysin O protein exhibits cytotoxic properties and has been shown to have an impact on collagen and adipose tissues. This protein is also involved in various biological processes, such as the regulation of glucagon and galectin-3, which are important for glucose metabolism and cell adhesion. In addition, Streptolysin O protein plays a role in interferon signaling pathways. Its unique properties make it a valuable tool for research in the field of Life Sciences.</p>

<p>Full antagonist to the estrogen beta receptor (ERβ) with 36-fold selectivity for the β over α receptor. ERβ is a tumour suppressor and PHTPP is a useful tool to study the biology of estrogen-dependent tumours.</p>

<p>Adenosine A3 receptor antagonist</p>

<p>Human IgM antibody was raised in mouse using immunoglobulin M Fab region as the immunogen.</p>

<p>H-NAFHQNDTIYSLTSAGR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-NAFHQNDTIYSLTSAGR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-NAFHQNDTIYSLTSAGR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-NAFHQNDTIYSLTSAGR-OH at the technical inquiry form on this page</p>

<p>SCH 529074 is a novel investigational compound that is classified as a small-molecule inhibitor, which is designed to modulate cellular signal transduction pathways. This product is derived from synthetic chemical processes, specifically tailored to interact with key molecular targets involved in disease pathophysiology. Its mode of action involves selectively binding to and inhibiting specific enzymes or receptors, thereby altering downstream signaling cascades within cells.</p>

<p>SUAM-14746 is a peptide that inhibits the interactions between proteins. It has been shown to be an activator of the receptor for nerve growth factor, and it may also inhibit the activity of ion channels. SUAM-14746 is a research tool for studying protein interactions and antibody binding. It is a high purity product with CAS number 126898-09-7.</p>

<p>Please enquire for more information about 1-O-Hexadecyl-rac-1,2-propandiol-2-phosphocholine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.</p>

<p>H-GHEYTNIK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GHEYTNIK-OH is provided at greater that Crude (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GHEYTNIK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GHEYTNIK-OH at the technical inquiry form on this page</p>

<p>Peptide H-GEAGPQGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>