Prodotti biochimici e reagenti

<p>Peptide H-LGDLYEEEMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SIIVFNLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-NRRRRWRERQR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FSLDLDQYPLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cathepsin D protein is a cytotoxic protein that acts as an inhibitory factor in various biological processes. It can be targeted by anti-ACTH antibodies or monoclonal antibodies for research purposes in the field of Life Sciences. Cathepsin D protein plays a role in the degradation of extracellular matrix components such as fibronectin and collagen. It has also been studied for its interaction with tyrosinase, insulin, and antiphospholipid antibodies. This acidic protein is involved in processes related to transferrin and isothiocyanate metabolism. For researchers looking to study native proteins and antigens, Cathepsin D protein can be a valuable tool.</p>

<p>Peptide H-SNTSESF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SYDLDPGAGSLEI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TLDPER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Lamin B1 (321-330) is derived from the nuclear envelope protein, Lamin B1 which plays a role in the regulation of epigenetic chromatin. The lysine residue at position 10 is isotopically labelled with carbon-13 (6) and nitrogen-15 (2).</p>

<p>Peptide H-IIADIFEYTAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>E. coli O157 antibody was raised in mouse using the 'O' antigen of E. coli serotype O157 as the immunogen.</p>

<p>H-LIELIDAVQR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LIELIDAVQR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LIELIDAVQR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LIELIDAVQR-OH at the technical inquiry form on this page</p>

<p>Peptide H-ISEGLPTPTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-YGGFLRRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified native Bovine 200 kDa Neurofilament protein</p>

<p>Peptide LCBiot-QEPEPPEPFEYIDD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-ITDGEA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Residues 1-10 of the gastrointestinal hormone motilin, secreted from endocrine cells in the small intestines, mainly from the jejunum and duodenum, in response to the fasting, drinking water or the mechanical stimulus of eating.</p>

<p>Highly purified native Human RBP protein</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a potent antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its efficacy has been demonstrated through transcription-quantitative polymerase chain reactions and patch-clamp techniques. Additionally, it undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Furthermore, it specifically targets Mycobacterium tuberculosis strains by binding to markers expressed at high levels in these strains.</p>

<p>Ac-CKYSTRHFDLGSKKSL-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CKYSTRHFDLGSKKSL-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CKYSTRHFDLGSKKSL-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CKYSTRHFDLGSKKSL-NH2 at the technical inquiry form on this page</p>

<p>Peptide H-GAIIGLMVGGVVI^A-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LQGTLPVEAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DI^TPTLTLYVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Nef is an accessory protein highly conserved amongst all primate lentiviruses, it is essential for viral replication in vivo- it is expressed by human immunodeficiency virus (HIV) HIV-1 and HIV-2. Nef acts as a downregulator of class I human leukocyte antigens (HLA) expression in HIV-infected cells to help circumvent the immune response, such as Cytotoxic T lymphocytes (CTL) activity. An intact nef gene is critical for high viral loads, linked to development of acquired immunodeficiency syndrome (AIDS). Certain alleles of HLA have been associated with maintaining a seronegative status such as HLA-A*1101.This nef peptide sequence contains the region considered to be a a C-proximal adaptor-protein (AP) interaction site. The presence of various nef motifs such as this are an intense area of investigation to understand if they are a factor in patients who remain clinically asymptomatic. This nef fragment is provided with an N-terminal acetyl group to increase its stability.</p>

<p>Peptide H-YPHYSLPGSSTL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Histone 4 (H4) is one of the four core histones (H2A, H2B, H3 and H4) which are essential for compacting eukaryotic DNA into the nucleosome. Due to the high lysine and arginine content, histones have a net positive charge and therefore electrostatically interact with negatively charged DNA. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Like other core histones, H4 has a globular domain and a flexible N-terminal domain, the histone tail, which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination.Gene transcriptional activation or inactivation is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes. Both processes function to alter the positioning of the nucleosome, allowing the DNA within to be either accessible to the transcription machinery or inaccessible. H4 lysine rich tail plays a role in the higher order chromatin folding.The lysine at position 16 has been acetylated, which neutralizes the positive charge on the amino acid, loosening the chromatin structure. This alteration to the accessibility of chromatin promotes the initiation of transcription.Acetyl-Histone H4 (1-23) K16Ac-GG-[Lys(5-FAM)] has a C-terminal GGK linker labelled with 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag. Additionally, this peptide has an uncharged C-terminal amide and is protected from N-terminal modifications by a covalently bonded acetyl group.</p>

<p>ASP-5286 is a research tool that can be used to study ion channels and ligand-receptor interactions. It is a peptide that binds to the extracellular domain of the human calcitonin receptor, an ion channel protein. This inhibitor can also be used in the study of receptor-ligand interactions. ASP-5286 has been shown to activate certain ion channels, such as calcium channels and potassium channels. It also inhibits other ion channels such as sodium channels. ASP-5286 is a high purity material with a CAS number of 132091-26-8.</p>

<p>Peptide H-GSISIQTEEQIHGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LVDQNIFSFYLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QFTSSTSYNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ALDNLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>ATP6V1E2 antibody was raised in Rabbit using Human ATP6V1E2 as the immunogen</p>

<p>Secondary SIL peptide for Rituximab detection and quantification</p>

<p>Peptide Fmoc-AAGIGILTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TTPPVL^DSDGSF^FLYSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RQDNEILIFWSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Clebopride is a dopamine antagonist drug that is used in the treatment of symptoms associated with gastrointestinal disorders. This drug is also used to treat nausea and vomiting. Clebopride blocks dopamine to allow an increase in the release of acetylcholine so that muscle movement in the digestive system is increased.</p>

<p>Peptide Biot-KKSRGDYMTMQIG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FRKKWNKWALSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>hCG alpha antibody (HRP) was raised in mouse using hCG alpha as the immunogen.</p>

<p>Hemoglobin epsilon antibody was raised in mouse using hemoglobin Gower-I (a2e2) isolated from culture fluids of the cell line K562 as the immunogen.</p>

<p>Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide 5FAM-EDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>