Prodotti biochimici e reagenti

<p>Lefamulin is an antibiotic, which is derived from the fermentation product of the fungus Pleuromutilin. It functions through a unique mode of action by binding to the peptidyl transferase center of the 50S ribosomal subunit, thereby inhibiting bacterial protein synthesis. This mechanism is distinct in that it interferes with key steps in the elongation phase of translation.</p>

<p>hCG beta antibody (HRP) was raised in mouse using hCG beta as the immunogen.</p>

<p>Inhibitor of β-lactamase enzymes</p>

<p>Inhibitor of 8-oxoguanine DNA glycosylase OGG1 with IC50 of 0.059 μM and excellent specificity over other DNA repair enzymes. OGG1 and its substrate 8-oxoguanine are involved in mutagenesis, genotoxicity, inflammation and cancer. The compound can cause accumulation of 8-oxoguanine in DNA in vitro and is a potent tool for the study of OGG1 biology.</p>

<p>Aloe-emodin is an anthraquinone derivative that is found in the aloe plant. It has a strong stimulant laxative action. Aloe-emodin may be useful in the treatment of cancer, as it inhibits cell proliferation by inducing apoptosis.</p>

<p>Inhibitor of tyrosinase in melanocytes: skin whitener</p>

<p>H-CGGHSILSRSQQYPAARP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGHSILSRSQQYPAARP-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGHSILSRSQQYPAARP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGHSILSRSQQYPAARP-OH at the technical inquiry form on this page</p>

<p>GAPDH antibody was raised in sheep using a 12 amino acid synthetic peptide (HQVVSSDFNSDT) representing the most conserved region of human and rat GAPDH conjugated with KLH as the immunogen.</p>

<p>Peptide H-LKLKSIVSWAKKVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>GLG1</p>

<p>DJ-1 play various roles in cellular homeostasis such as protein quality control, mitochondrial function, protecting cells from oxidative injury, and regulating gene transcription.DJ-1 can activate the extracellular signal-regulated kinase (ERK1/2) pathway to mediate dopamine (DA) homeostasis and mutations in PARK7, the gene which encodes DJ-1 can cause autosomal-recessive early-onset parkinsonism. Activation of the ERK pathway also plays a role in oncogenesis by encouraging inappropriate cell proliferation and survival. Overexpression and secretion of DJ-1 is associated with a vast number of tumour types. DJ-1 can also activate the phosphatidylinositol-3-kinase PI3k/Akt pathway to mediate stress-induced cellular responses such as cell survival and proliferation. The role of DJ-1 in this pathway is linked to multiple disease states such as: Alzheimer disease- Parkinson disease- clear cell renal cell carcinoma (ccRCC)- renal tubular epithelial-mesenchymal transition (EMT), and metastasis of gastric carcinoma.DJ-1 can inhibit apoptosis signal-regulating kinase 1 (ASK1) activation, also known as mitogen-activated protein kinase kinase kinase 5 (MAP3K5), as well as mitogen-activated protein kinase kinase kinase 1 (MEKK1/MAP3K1) activation to attenuate apoptosis. DJ-1 also acts on several signalling pathways to modulate autophagy such as activation of the PI3K/AKT pathway and the non-canonical MEK/ERK-mTOR Pathway and suppression of the JNK/Beclin 1 pathway.The leucine residue at position 9 of this peptide is isotopically labelled with carbon-13 (6) and nitrogen-15 (1), giving this peptide a mass increase of 7 compared to the unlabelled peptide.</p>

<p>Neisseria gonorrhoeae antibody is a monoclonal antibody that acts as a family kinase inhibitor. It belongs to the class of monoclonal antibodies used in Life Sciences research. This antibody has neutralizing properties and can inhibit the growth factor activity of Neisseria gonorrhoeae. It binds specifically to activated N. gonorrhoeae and prevents their proliferation. Additionally, this antibody has been shown to have therapeutic potential in treating autoantibody-mediated diseases and regulating the function of mesenchymal stem cells. Its effectiveness has been validated using mass spectrometric methods, which have demonstrated its ability to inhibit serine protease activity in nuclear extracts.</p>

<p>E3 Ubiquitin ligase proteins mediate ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme as a thioester and then directly transfer the ubiquitin to targeted substrates. DZIP3 is located in the cytoplasm and can specifically bind RNA. DZIP3 enables several functions, including phosphatase binding activity; polyubiquitin modification-dependent protein binding activity; and ubiquitin-protein transferase activity. In addition, DZIP3 is involved in protein polyubiquitination._x000D_<br>_x000D_<br>The condition of azoospermia is associated with the deletion of DZIP3. High expression of DZIP3 is a biomarker for a poor outcome of several cancers, including gastric and breast cancer. DZIP3 is a crucial driver of cancer cell growth, migration, and invasion due to interacting with cyclin D1 during G1. In breast cancer, DZIP3 is a coactivator of oestrogen receptor α target gene expression and enhances their expression in breast cancer cells.</p>

<p>Please enquire for more information about Anti-ANO1 antibody R2G - 1mg/mL including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Apelin (65-76), human is derived from the apelin peptide which acts as a ligand for the apelin receptor (APJ) G protein coupled receptor and is a substrate for angiotensin converting enzyme 2. Preprapelin, encoded for by APLN located on Xq25-26.1, is cleaved to form either apelin 36 or apelin 17, 12 and 13. As a member of the adipokine hormone family, which are involved in processes such as vascular homeostasis and angiogenesis, the apelin is secreted from adipose tissue.Apelin has been found to be expressed in the spinal cord and the human brain and when performing immunohistochemistry it was observed that apelin-17 is significantly expressed in the human heart, brain, lungs and endothelial cells.Both apelin and the apelin receptor are widely distributed around the body thus apelin has been found to be associated with cardiovascular diseases, obesity, diabetes and cancer. Studies exploring myocardial infarction showed there to be greater apelin mRNA expression during human heart failure compared to in healthy tissue. Apelin protects against heart failure due to, the pyroglutamyl form of apelin, playing a role in decreasing infarct size of myocardial infarctions. Furthermore in rats with hypertension, the expression of apelin and APJ was decreased.</p>

<p>Originally identified in Gila monster lizard (Heloderma suspectum), exendin-4 is an incretin mimetic, an analog of glucagon-like-peptide-1 (GLP-1), it stimulates insulin secretion and modulates gastric emptying to slow the entry of ingested sugars into the bloodstream. Exendin-4 is resistant to cleavage by plasma DPP-IV unlike GLP-1. This gives it a longer half-life and duration of action than GLP-1, as well as greater potency in vivo. Exendin-4 increases insulin sensitivity and improves glucose tolerance and is currently used for the treatment of Type 2 diabetes mellitus in its synthetic form Exenatide.Exendin-4 also promotes the production and proliferation of β-cells leading to regeneration of the pancreas. It is a ligand to the exendin receptor and increases pancreatic acinni cAMP levels. However, the GLP-1 analog was found to have a toxic effect by inducing hypotension due to relaxation of the cardiac smooth muscle.The leucine residues at positions 10, 21, and 26 of this peptide are isotopically labelled with carbon-13 and nitrogen-15, giving this peptide a mass increase of 18.5 compared to the unlabelled peptide.</p>

<p>H-DTRPWSGPYILRNQD-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DTRPWSGPYILRNQD-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DTRPWSGPYILRNQD-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DTRPWSGPYILRNQD-OH at the technical inquiry form on this page</p>

<p>Peptide H-QVLQVTPFAER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about Atrial natriuretic factor (1-28) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-methyl-D-aspartate receptors (NMDARs) are ligand-gated ionotropic glutamate receptors that mediate excitatory synaptic transmission and play important roles in many aspects of nervous system function including: synaptic plasticity; learning and memory; neuronal development and circuit formation. In addition NMDARs have also been implicated in various neuronal disorders. NMDARs are heteromers consisting of an obligate NR1 subunit and most commonly one or two kinds of NR2 subunits or occasionally NR3 subunits.</p>

<p>Research peptide, 95% TFA salt</p>

<p>Please enquire for more information about TBE IgG Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>MS1 is a peptide that binds to the pro-survival protein Mcl-1, disrupting its ability to inhibit cell death. It is used in research to study how cancer cells depend on Mcl-1 for survival and to assess the effectiveness of drugs that target this protein. Modifications to the MS1 peptide, such as stapling and introducing mutations, can further enhance its binding affinity to Mcl-1, making it a valuable tool in developing new cancer therapies.</p>

<p>Rabbit polyclonal Ferritin heavy chain antibody (biotin)</p>

<p>Peptide H-TDTGVSLQTYDDLLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Please enquire for more information about IgM Mu Chain Goat Polyclonal Antibody, Affinity Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PSA antibody was raised in mouse using highly purified human PSA as the immunogen.</p>

<p>Research peptide, 95% TFA salt</p>

<p>For preparation of acids, alcohols, thiols, or amines</p>

<p>SLC27A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPL</p>

<p>Anti-PDE2A3 antibody</p>

<p>Famotidine is a selective histamine H2-receptor antagonist used in the treatment of gastric hypersecretory disorders. Famotidine is effective in the treatment of duodenal and gastric ulcers, particularly when they are caused by the prolonged use of nonsteroidal antiinflammatory drugs (NSAIDs). To improve retention in the stomach, famotidine has experimentally been formulated as buoyant tablets that remained floating for up to 10 hours in vitro (Jaimini, 2007).</p>

<p>Durlobactam sodium is a β-lactamase inhibitor, which is a synthetic compound designed to enhance the efficacy of β-lactam antibiotics. It is sourced through chemical synthesis, allowing precise control over its structural and pharmacological properties. Durlobactam sodium functions by inhibiting the activity of β-lactamase enzymes produced by resistant bacterial strains. These enzymes typically degrade β-lactam antibiotics, rendering them ineffective. By blocking this enzymatic action, durlobactam sodium protects the antibiotic, restoring and even enhancing its bacterial killing ability.</p>

<p>Purified recombinant RAB3B protein</p>

<p>Rabbit polyclonal STAT5A antibody (Tyr694)</p>

<p>GSS-acid is a tripeptide consisting of a glycine residue followed by two serine residues. GSS-acid was synthesised from the dipeptide glycyl-L-serine (GS-acid)- the dipeptide GS-acid is also available in our catalogue. GSS-acid has a net charge of 0 and has diverse biological and chemical uses.</p>

<p>Catalase antibody was raised in rabbit using bovine liver catalase as the immunogen.</p>

<p>The synthetic canonical Flag sequence has been shown to be most effective with the Asp-Tyr-Lys-Xaa-Xaa-Asp motif triplicated for applications in protein analysis followed by the eight amino acids at the C-terminus of the classic FLAG sequence (Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys). Due to the hydrophilic nature of the peptide the Flag tag typically resides on the surface of the recombinant protein thus minimising any effects on the function or transport of the fusion protein. The tag can be used in conjunction with other tags such as HA or myc depending on the application. FLAG is an artificial antigen to which high affinity monoclonal antibodies have been raised, therefore allowing for highly effective protein purification by affinity chromatography as well as accurate localisation of FLAG tagged proteins within living cells, or Western blots. FLAG peptide can be used to effectively purify complexes with multiple proteins as its mild purification procedure tends not to disrupt such complexes. It can be used to obtain proteins of sufficient purity for x-ray crystallography. The 3 x Flag peptide provides powerful detection and purification of recombinant proteins that has been characterised in numerous applications including affinity chromatography, binding assays and structural analysis.</p>

<p>Biotin-PEG2-Claudin-3 is derived from the tight junction protein Claudin-3 which is encoded by the CLDN3 gene located on chromosome 7q11.23 and can be found within epithelial cell to cell contacts. Structurally, the Claudin family are transmembrane proteins containing two extracellular loops and are involved in maintaining cell polarity and controlling paracellular ion flux.During cancer research reduction in the number of Claudins has been associated with tumour formation. This could be explained using Claudin role in maintaining cell detachment and migration although cancers such as breast and prostate have shown to overexpress both Claudin- 3 and Claudin-4. Similarly in ovarian cancer overexpression of Claudin 3 and 4 is thought to increase the motility of tumour cells and their survival through basement membrane degrading matrix metalloproteinase activation.Both Claudin 3 and 4 have potential to be used as diagnostic markers and their two extracellular loops may be used as targets for antibodies. As receptors for the Clostridium perfringens enterotoxin, Claudin 3 and 4 may have further use in targeting the enterotoxin as a therapeutic for ovarian cancers.This peptide has a covalently bonded N-terminal Biotin tag that can be used for detection and purification and contains a polyethylene glycol spacer (PEG2).</p>

<p>Folic acid-BSA is a Hapten Conjugate that consists of folic acid conjugated to bovine serum albumin (BSA). It is commonly used in various research applications in the field of Life Sciences. Folic acid-BSA can be utilized as an antigen to generate monoclonal antibodies specific to folic acid. These antibodies can then be employed in immunoassays, such as ELISA, for the detection and quantification of folic acid in biological samples. Additionally, folic acid-BSA has been used as a carrier protein for the development of DNA vaccines. By conjugating folic acid to BSA, it enhances the immunogenicity of the DNA vaccine and promotes a stronger immune response. This approach has shown promising results in preclinical studies, demonstrating its potential for future use in vaccine development. Furthermore, folic acid-BSA has been utilized in electrode-based assays for the detection of biomolecules. The conjugate acts as a</p>

<p>FABP protein is a growth factor that plays a crucial role in various biological processes. It can be targeted using monoclonal antibodies, which have been developed to specifically bind to FABP protein. Fatty acids are known to interact with FABP protein, and this interaction has implications for adipose tissue metabolism and natriuretic regulation. Additionally, FABP protein has been shown to bind aromatic amino acids and phorbol esters, suggesting its involvement in signal transduction pathways.</p>

<p>Nicotinic receptor antagonist</p>

<p>Chlamydia trachomatis antibody is a valuable tool in the field of Life Sciences. It is a monoclonal antibody specifically designed to target and bind to the antigen of Chlamydia trachomatis, a common sexually transmitted infection. This antibody can be used for various applications, including diagnostic assays and research studies.</p>

<p>ApoA-I antibody was raised in mouse using human apolipoprotein A-1 (HDL) as the immunogen.</p>

<p>Ac-KGHDGLYQGLSTATK-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-KGHDGLYQGLSTATK-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-KGHDGLYQGLSTATK-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-KGHDGLYQGLSTATK-NH2 at the technical inquiry form on this page</p>

<p>Mitochondria contain 4 multimeric electron transfer complexes (CI-CIV) that allow a stepwise transfer of electrons leading to energy production. The electron transfer complexes can form supercomplexes with a core of monomeric CI and dimeric CIII. The purpose of the supercomplex is believed to be direct electron transfer in a discrete unit with additional structural roles in the mitochondria. NDUFA11 is a conserved integral membrane protein that sits at the interface of CI and CIII. Lack of functional NDUFA11 leads to infant death, and encephalocardiomyopathy.</p>

<p>Anti-UCP1 antibody</p>

<p>Peptide H-A^^P^^G^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Pathogenic Staphylococcus aureus strains produce N-formylmethionyl containing peptides. Peptides starting with an N-formylated methionyl group constitute a unique hallmark of bacterial as well as mitochondrial metabolism, and professional phagocytes of our innate immune system recognise this microbial/mitochondrial pattern as a danger signal that guides innate immune cells.All PSMα peptides have the same basic functions and promote virulence through effects on discrete neutrophil functions (i.e. chemotaxis) and by being cytotoxic at higher concentrations. PSMα2 and PSMα3 can both bind to FPR2 and trigger superoxide release in neutrophils at low nanomolar concentrations. In addition, at high nanomolar concentrations they display cytotoxicity selectively on apoptotic neutrophil membranes and this occurs in an FPR2 independent manner.</p>

<p>Peptide Ac-PAVLQSSGLYSLSSVVTVPSSSLGTQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>