Prodotto aggiunto correttamente al carrello.

Biochemicals and Reagents
Biochemicals and Reagents

Prodotti biochimici e reagenti

I biochimici e i reagenti sono sostanze fondamentali per la ricerca e lo sviluppo in campi come la biotecnologia, la biologia molecolare, la farmacologia e la medicina. Questi prodotti sono essenziali per una varietà di applicazioni, tra cui la sintesi di composti, l'analisi di campioni biologici, la ricerca sui processi metabolici e la produzione di farmaci. Presso CymitQuimica offriamo un'ampia selezione di biochimici e reagenti di alta qualità e purezza, adatti a diverse esigenze scientifiche e industriali. Il nostro catalogo include enzimi, anticorpi, acidi nucleici, amminoacidi e molti altri prodotti, tutti progettati per supportare i ricercatori e i professionisti nei loro progetti di ricerca e sviluppo, garantendo risultati affidabili e riproducibili.

Leggi di più

Prodotti di "Prodotti biochimici e reagenti"

Ordinare per


Vedere altre categorie

Questa ricerca non contiene alcuna categoria.

prodotti per pagina. 178194 prodotti in questa categoria.

MarchioDati del prodottoPurezzaFascia di prezzoConsegna prevista
Biosynth logo
MMP Substrate I, fluorogenic
REF: 3D-VAC-00144
- - -173,00 €~652,00 €Gio 05 Dic 24
Biosynth logo
β-Casomorphin (1-4) (bovine)
REF: 3D-VAC-00905
- - -196,00 €~492,00 €Gio 05 Dic 24
Biosynth logo
Kinase Domain of Insulin Receptor (1)
REF: 3D-VAC-00862
- - -342,00 €~966,00 €Gio 05 Dic 24
Biosynth logo
Antho-Rwamide I
REF: 3D-VAC-00199
- - -250,00 €~695,00 €Gio 05 Dic 24
Biosynth logo
Dok-5 (263-275)
REF: 3D-VAC-00579
- - -352,00 €~993,00 €Gio 05 Dic 24
Biosynth logo
HPV-E6-N
REF: 3D-VAC-00340
- - -158,00 €~594,00 €Gio 05 Dic 24
Biosynth logo
H-Ile-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
REF: 3D-FI111777
Min. 95%200,00 €~1.500,00 €Gio 05 Dic 24
Biosynth logo
[D-Val22, Phe33] Big Endothelin-1 (16-38), human
REF: 3D-VAC-00478
- - -212,00 €~842,00 €Gio 05 Dic 24
Biosynth logo
Big Gastrin-1, human
REF: 3D-VAC-00188
- - -288,00 €~1.078,00 €Gio 05 Dic 24
Biosynth logo
Neuropeptide Y-Lys(Biotin), human, rat
REF: 3D-VAC-00128
- - -365,00 €~1.454,00 €Gio 05 Dic 24
Biosynth logo
EMP-1 (Epithelial Membrane Protein)
REF: 3D-VAC-00423
- - -191,00 €~759,00 €Gio 05 Dic 24
Biosynth logo
α-Casein (90-95)
REF: 3D-VAC-00701
- - -196,00 €~492,00 €Gio 05 Dic 24
Biosynth logo
HIV-1, HIV-2 Protease Substrate
REF: 3D-VAC-00258
- - -291,00 €~773,00 €Gio 05 Dic 24
Biosynth logo
[Glu3,4,7,10,14]-Conantokin G
REF: 3D-VAC-00410
- - -229,00 €~911,00 €Gio 05 Dic 24
Biosynth logo
VIP-Lys(Biotin), human, porcine, rat
REF: 3D-VAC-00484
- - -345,00 €~1.376,00 €Gio 05 Dic 24
Biosynth logo
H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
REF: 3D-PP47266
- - -Prezzo su richiestaGio 05 Dic 24
Biosynth logo
β-Amyloid (10-20)
REF: 3D-VAC-00864
- - -312,00 €~828,00 €Gio 05 Dic 24
Biosynth logo
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (37-42)
REF: 3D-VAC-00271
- - -312,00 €~828,00 €Gio 05 Dic 24
Biosynth logo
Ser-Ala-SAP-IIB
REF: 3D-VAC-00702
- - -162,00 €~608,00 €Gio 05 Dic 24
Biosynth logo
GSK3 Peptide Substrate
REF: 3D-VAC-00446
- - -291,00 €~579,00 €Gio 05 Dic 24
discount label

MMP Substrate I, fluorogenic


Ref: 3D-VAC-00144

1mg173,00 €
5mg439,00 €
10mg652,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

β-Casomorphin (1-4) (bovine)


Ref: 3D-VAC-00905

5mg196,00 €
10mg295,00 €
25mg492,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

Kinase Domain of Insulin Receptor (1)


Ref: 3D-VAC-00862

5mg342,00 €
10mg507,00 €
25mg966,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

Antho-Rwamide I


Ref: 3D-VAC-00199

5mg250,00 €
10mg391,00 €
25mg695,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

Dok-5 (263-275)


Ref: 3D-VAC-00579

5mg352,00 €
10mg521,00 €
25mg993,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

HPV-E6-N


Ref: 3D-VAC-00340

1mg158,00 €
5mg400,00 €
10mg594,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

H-Ile-2-chlorotrityl resin (200-400 mesh) (Low Substitution)


Ref: 3D-FI111777

1g329,00 €
2g478,00 €
5g968,00 €
10g1.500,00 €
500mg200,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

[D-Val22, Phe33] Big Endothelin-1 (16-38), human


Ref: 3D-VAC-00478

1mg212,00 €
5mg530,00 €
10mg842,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

Big Gastrin-1, human


Ref: 3D-VAC-00188

1mg288,00 €
5mg721,00 €
10mg1.078,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

Neuropeptide Y-Lys(Biotin), human, rat


Ref: 3D-VAC-00128

1mg365,00 €
5mg927,00 €
10mg1.454,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

EMP-1 (Epithelial Membrane Protein)


Ref: 3D-VAC-00423

1mg191,00 €
5mg478,00 €
10mg759,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

α-Casein (90-95)


Ref: 3D-VAC-00701

5mg196,00 €
10mg295,00 €
25mg492,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

HIV-1, HIV-2 Protease Substrate


Ref: 3D-VAC-00258

5mg291,00 €
10mg456,00 €
25mg773,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

[Glu3,4,7,10,14]-Conantokin G


Ref: 3D-VAC-00410

1mg229,00 €
5mg573,00 €
10mg911,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

VIP-Lys(Biotin), human, porcine, rat


Ref: 3D-VAC-00484

1mg345,00 €
5mg878,00 €
10mg1.376,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH


Ref: 3D-PP47266

1mgPrezzo su richiesta
10mgPrezzo su richiesta
100mgPrezzo su richiesta
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

β-Amyloid (10-20)


Ref: 3D-VAC-00864

5mg312,00 €
10mg488,00 €
25mg828,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (37-42)


Ref: 3D-VAC-00271

5mg312,00 €
10mg488,00 €
25mg828,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

Ser-Ala-SAP-IIB


Ref: 3D-VAC-00702

1mg162,00 €
5mg410,00 €
10mg608,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

GSK3 Peptide Substrate


Ref: 3D-VAC-00446

5mg291,00 €
10mg456,00 €
25mg579,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
Benvenuto su CymitQuimica!Utilizziamo i cookie per migliorare la tua visita. Non includiamo pubblicità.

Consulta la nostra Politica sui Cookie per maggiori dettagli o regola le tue preferenze in "Configura".