Prodotto aggiunto correttamente al carrello.

Biochemicals and Reagents
Biochemicals and Reagents

Prodotti biochimici e reagenti

I biochimici e i reagenti sono sostanze fondamentali per la ricerca e lo sviluppo in campi come la biotecnologia, la biologia molecolare, la farmacologia e la medicina. Questi prodotti sono essenziali per una varietà di applicazioni, tra cui la sintesi di composti, l'analisi di campioni biologici, la ricerca sui processi metabolici e la produzione di farmaci. Presso CymitQuimica offriamo un'ampia selezione di biochimici e reagenti di alta qualità e purezza, adatti a diverse esigenze scientifiche e industriali. Il nostro catalogo include enzimi, anticorpi, acidi nucleici, amminoacidi e molti altri prodotti, tutti progettati per supportare i ricercatori e i professionisti nei loro progetti di ricerca e sviluppo, garantendo risultati affidabili e riproducibili.

Leggi di più

Prodotti di "Prodotti biochimici e reagenti"

Ordinare per


Vedere altre categorie

Questa ricerca non contiene alcuna categoria.

prodotti per pagina. 178192 prodotti in questa categoria.

MarchioDati del prodottoPurezzaFascia di prezzoConsegna prevista
Biosynth logo
H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
REF: 3D-PP47266
- - -Prezzo su richiestaGio 05 Dic 24
Biosynth logo
tert-Butyi-(1R, 5S)-2-amino edoxaban oxalate
REF: 3D-DCD72931
CAS: 1928729-31-0
Min. 95%116,00 €~700,00 €Gio 05 Dic 24
Biosynth logo
VIP-Lys(Biotin), human, porcine, rat
REF: 3D-VAC-00484
- - -345,00 €~1.376,00 €Gio 05 Dic 24
Biosynth logo
[Glu3,4,7,10,14]-Conantokin G
REF: 3D-VAC-00410
- - -229,00 €~911,00 €Gio 05 Dic 24
Biosynth logo
HIV-1, HIV-2 Protease Substrate
REF: 3D-VAC-00258
- - -291,00 €~773,00 €Gio 05 Dic 24
Biosynth logo
[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257)
REF: 3D-VAC-00427
- - -184,00 €~731,00 €Gio 05 Dic 24
Biosynth logo
[Ala3,11,18, Nle7] Endothelin-1, human
REF: 3D-VAC-00286
- - -201,00 €~800,00 €Gio 05 Dic 24
Biosynth logo
Prepro VIP (111-122) (human)
REF: 3D-VAC-00814
- - -343,00 €~911,00 €Gio 05 Dic 24
Biosynth logo
α-Casomorphin (1-2)
REF: 3D-VAC-00907
- - -196,00 €~492,00 €Gio 05 Dic 24
Biosynth logo
HPV-E6-C
REF: 3D-VAC-00630
- - -191,00 €~759,00 €Gio 05 Dic 24
Biosynth logo
Erythromycin resistance peptide
REF: 3D-VAC-00611
- - -215,00 €~579,00 €Gio 05 Dic 24
Biosynth logo
α-Helical CRF (9-41)
REF: 3D-VAC-00333
- - -326,00 €~1.220,00 €Gio 05 Dic 24
Biosynth logo
TNF-α(71-82), human
REF: 3D-VAC-00735
- - -343,00 €~911,00 €Gio 05 Dic 24
Biosynth logo
PLM derived peptide
REF: 3D-VAC-00509
- - -260,00 €~724,00 €Gio 05 Dic 24
Biosynth logo
Fas C-Terminal Tripeptide
REF: 3D-VAC-00050
- - -196,00 €~492,00 €Gio 05 Dic 24
Biosynth logo
MAP Kinase Substrate
REF: 3D-VAC-00546
- - -201,00 €~800,00 €Gio 05 Dic 24
Biosynth logo
1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine
REF: 3D-FO111158
CAS: 1035010-98-0
Min. 95%203,00 €~1.065,00 €Gio 05 Dic 24
Biosynth logo
(D-His(Bzl)6)-LHRH (1-7) (free acid)
REF: 3D-FH109369
CAS: 1926163-27-0
Min. 95%343,00 €~2.785,00 €Gio 05 Dic 24
Biosynth logo
β-Amyloid (2-40)
REF: 3D-VAC-00212
- - -521,00 €~2.336,00 €Gio 05 Dic 24
Biosynth logo
[Met5,Arg6,7,Val8,Gly9] Enkephalin
REF: 3D-VAC-00877
- - -260,00 €~724,00 €Gio 05 Dic 24
discount label

H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH


Ref: 3D-PP47266

1mgPrezzo su richiesta
10mgPrezzo su richiesta
100mgPrezzo su richiesta
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

tert-Butyi-(1R, 5S)-2-amino edoxaban oxalate


Ref: 3D-DCD72931

1mg116,00 €
2mg186,00 €
5mg335,00 €
10mg455,00 €
25mg700,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

VIP-Lys(Biotin), human, porcine, rat


Ref: 3D-VAC-00484

1mg345,00 €
5mg878,00 €
10mg1.376,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

[Glu3,4,7,10,14]-Conantokin G


Ref: 3D-VAC-00410

1mg229,00 €
5mg573,00 €
10mg911,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

HIV-1, HIV-2 Protease Substrate


Ref: 3D-VAC-00258

5mg291,00 €
10mg456,00 €
25mg773,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257)


Ref: 3D-VAC-00427

1mg184,00 €
5mg461,00 €
10mg731,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

[Ala3,11,18, Nle7] Endothelin-1, human


Ref: 3D-VAC-00286

1mg201,00 €
5mg504,00 €
10mg800,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

Prepro VIP (111-122) (human)


Ref: 3D-VAC-00814

5mg343,00 €
10mg478,00 €
25mg911,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

α-Casomorphin (1-2)


Ref: 3D-VAC-00907

5mg196,00 €
10mg295,00 €
25mg492,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

HPV-E6-C


Ref: 3D-VAC-00630

1mg191,00 €
5mg478,00 €
10mg759,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

Erythromycin resistance peptide


Ref: 3D-VAC-00611

5mg215,00 €
10mg347,00 €
25mg579,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

α-Helical CRF (9-41)


Ref: 3D-VAC-00333

1mg326,00 €
5mg778,00 €
10mg1.220,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

TNF-α(71-82), human


Ref: 3D-VAC-00735

5mg343,00 €
10mg478,00 €
25mg911,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

PLM derived peptide


Ref: 3D-VAC-00509

5mg260,00 €
10mg407,00 €
25mg724,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

Fas C-Terminal Tripeptide


Ref: 3D-VAC-00050

5mg196,00 €
10mg295,00 €
25mg492,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

MAP Kinase Substrate


Ref: 3D-VAC-00546

1mg201,00 €
5mg504,00 €
10mg800,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine


Ref: 3D-FO111158

25mg203,00 €
50mg290,00 €
100mg437,00 €
250mg729,00 €
500mg1.065,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

(D-His(Bzl)6)-LHRH (1-7) (free acid)


Ref: 3D-FH109369

1mg526,00 €
2mg888,00 €
5mg1.660,00 €
10mg2.785,00 €
500µg343,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

β-Amyloid (2-40)


Ref: 3D-VAC-00212

1mg521,00 €
5mg1.402,00 €
10mg2.336,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
discount label

[Met5,Arg6,7,Val8,Gly9] Enkephalin


Ref: 3D-VAC-00877

5mg260,00 €
10mg407,00 €
25mg724,00 €
Consegna stimata in Stati Uniti, il Giovedì 05 Dicembre 2024
Benvenuto su CymitQuimica!Utilizziamo i cookie per migliorare la tua visita. Non includiamo pubblicità.

Consulta la nostra Politica sui Cookie per maggiori dettagli o regola le tue preferenze in "Configura".