CymitQuimica logo
Anticorpi primari

Anticorpi primari

Gli anticorpi primari sono immunoglobuline che si legano specificamente a un antigene di interesse, consentendo la rilevazione e quantificazione di proteine, peptidi o altre biomolecole. Questi anticorpi sono strumenti fondamentali in un'ampia gamma di applicazioni, tra cui Western blot, immunoistochimica ed ELISA. Presso CymitQuimica, offriamo una vasta selezione di anticorpi primari di alta qualità, che garantiscono specificità e sensibilità per vari bisogni di ricerca, tra cui studi su cancro, immunologia e biologia cellulare.

Sottocategorie di "Anticorpi primari "

Mostrare 1 più sottocategorie

Trovati 75327 prodotti di "Anticorpi primari "

Ordinare per

Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
prodotti per pagina.
  • USP35 antibody


    Purified Rabbit polyclonal USP35 antibody

    Ref: 3D-70R-35192

    1u
    Fuori produzione
    100µg
    Fuori produzione
    Prodotto fuori produzione
  • Laminin antibody


    The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug from the class of rifamycins. It is specifically designed to combat tuberculosis infection and contains active compounds that exhibit strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. It has been extensively tested using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.

    Ref: 3D-10R-7867

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • USP20 antibody


    Rabbit polyclonal USP20 antibody

    Ref: 3D-70R-21198

    1u
    Fuori produzione
    50µl
    Fuori produzione
    Prodotto fuori produzione
  • IP6K3 antibody


    Rabbit polyclonal IP6K3 antibody

    Ref: 3D-70R-32081

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • SARS-CoV-2 Spike Antibody


    The SARS-CoV-2 Spike Antibody is a highly effective tool for immunoassays and research in the field of Life Sciences. This antibody specifically targets the spike protein of the SARS-CoV-2 virus, which is responsible for receptor binding and entry into host cells.

    Ref: 3D-10-2869

    1mg
    Fuori produzione
    Prodotto fuori produzione
  • MHC class II antibody (PE)


    Mouse monoclonal MHC class II antibody (PE)

    Ref: 3D-61R-1391

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • CKB antibody


    The CKB antibody is a polyclonal antibody that specifically targets the creatine kinase B (CKB) protein. This antibody is widely used in Life Sciences research to study various cellular processes and signaling pathways. The CKB protein plays a crucial role in energy metabolism by catalyzing the reversible transfer of phosphate between ATP and creatine, thus providing a readily available source of energy for cells. It is primarily expressed in tissues with high-energy demands, such as skeletal muscle, heart, and brain.

    Ref: 3D-70R-33146

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • CREG1 antibody


    Mouse monoclonal anti human CREG1 antibody

    Ref: 3D-10R-11299

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • SEMA3D antibody


    SEMA3D antibody was raised using the middle region of SEMA3D corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS

    Purezza:Min. 95%

    Ref: 3D-70R-6406

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • Lp-PLA2 polyclonal antibody


    Rabbit anti-human patelet-activating factor acetylhydrolase(Lp-PLA2)  polyclonal Antibody

    Purezza:Min. 95%

    Ref: 3D-20R-3026

    1mg
    Fuori produzione
    Prodotto fuori produzione
  • Claudin 14 antibody


    Affinity purified Rabbit polyclonal Claudin 14 antibody

    Ref: 3D-70R-12838

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • Lactoferrin antibody


    The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied and proven to be active using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.

    Ref: 3D-10-L100A

    1mg
    Fuori produzione
    Prodotto fuori produzione
  • ST8SIA2 antibody


    Rabbit polyclonal ST8SIA2 antibody

    Ref: 3D-70R-21711

    50µl
    Fuori produzione
    Prodotto fuori produzione
  • Cip1 antibody


    Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.

    Purezza:Min. 95%

    Ref: 3D-70R-CR057

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • Tetanus toxin antibody


    Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.

    Purezza:>92% By Gel Electrophoresis And Gel Scanning

    Ref: 3D-10-1558

    1u
    Fuori produzione
    1mg
    Fuori produzione
    Prodotto fuori produzione
  • CD203c antibody


    CD203c antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to DNA binding proteins that play a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in glycosylation studies, where it helps researchers understand the role of glycosylation in protein function and regulation.

    Ref: 3D-70R-50188

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • Tetanus toxin antibody


    Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.

    Ref: 3D-10-1559

    1mg
    Fuori produzione
    Prodotto fuori produzione
  • DPY19L4 antibody


    DPY19L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR

    Purezza:Min. 95%

    Ref: 3D-70R-7039

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • Chlamydia trachomatis antibody (FITC)


    Chlamydia trachomatis antibody (FITC) was raised in rabbit using L2 and other serovar groups as the immunogen.

    Ref: 3D-60-C19

    1ml
    Fuori produzione
    Prodotto fuori produzione
  • UBE2H antibody


    Rabbit polyclonal UBE2H antibody

    Ref: 3D-70R-21106

    1u
    Fuori produzione
    50µl
    Fuori produzione
    Prodotto fuori produzione
  • anti-Cat IgE Antibody Monoclonal


    Purified Mouse anti-Cat IgE Antibody

    Purezza:Min. 95%

    Ref: 3D-10-8186

    ne
    Fuori produzione
    1mg
    Fuori produzione
    Prodotto fuori produzione
  • Myeloperoxidase antibody


    Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.

    Ref: 3D-10-M92A

    1u
    Fuori produzione
    1mg
    Fuori produzione
    Prodotto fuori produzione
  • NDUFA4 antibody


    Purified Rabbit polyclonal NDUFA4 antibody

    Ref: 3D-70R-35580

    1u
    Fuori produzione
    100µg
    Fuori produzione
    Prodotto fuori produzione
  • PASP antibody


    Rabbit polyclonal PASP antibody

    Ref: 3D-70R-21640

    50µl
    Fuori produzione
    Prodotto fuori produzione
  • S6K1 antibody


    The S6K1 antibody is a potent inhibitor of thrombocytopenia, which is the condition of having low platelet count. It works by blocking the action of interleukin-6, a cytokine that plays a role in platelet production. This monoclonal antibody is widely used in Life Sciences research as a tool to study the function of S6K1, a family kinase involved in cell growth and proliferation. In addition to its use as a research tool, this antibody also has potential therapeutic applications. Its inhibitory effects on S6K1 make it a promising candidate for the development of targeted therapies against diseases characterized by abnormal cell growth, such as cancer. Furthermore, it has been shown to have an impact on viscosity regulation and can modulate the activity of various growth factors and chemokines involved in tissue repair and regeneration. Whether you are studying mesenchymal stem cells or investigating the role of epidermal growth factor or collagen in certain conditions, this

    Purezza:Min. 95%

    Ref: 3D-70R-51632

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • NDUFS1 antibody


    Purified Polyclonal NDUFS1 antibody

    Ref: 3D-70R-50110

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • TMEM141 antibody


    Rabbit polyclonal TMEM141 antibody

    Ref: 3D-70R-20867

    50µl
    Fuori produzione
    Prodotto fuori produzione