Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.620 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(751 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.709 prodotti)
- Anticorpi metabolici(279 prodotti)
- Anticorpi per la microbiologia(738 prodotti)
- Trasduzione del segnale(2.717 prodotti)
- Tag e marcatori cellulari(33 prodotti)
Trovati 75327 prodotti di "Anticorpi primari "
HTRA4 antibody
HTRA4 antibody was raised using the middle region of HTRA4 corresponding to a region with amino acids LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTDPurezza:Min. 95%CREB antibody
The CREB antibody is a growth factor that belongs to the class of polyclonal antibodies. It specifically targets the activated form of CREB (cAMP response element-binding protein), which plays a crucial role in various cellular processes. This antibody inhibits the activity of CREB by preventing its phosphorylation, thereby disrupting downstream signaling pathways. The high specificity and affinity of this antibody have been demonstrated through extensive research in Life Sciences. Additionally, it has been shown to exhibit neutralizing properties against CREB kinase activity, making it an excellent tool for studying the function of this protein. The colloidal nature of this antibody ensures efficient antigen-antibody reactions, enhancing its effectiveness in experimental settings. Furthermore, this antibody has low viscosity in human serum, allowing for easy handling and application. Whether you're conducting research or developing therapeutic inhibitors, the CREB antibody is an invaluable resource that guarantees reliable results.
SRR antibody
SRR antibody was raised using the middle region of SRR corresponding to a region with amino acids GVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ
Acetyl Lysine Antibody
The Acetyl Lysine Antibody is a highly specific monoclonal antibody that recognizes acetylated lysine residues. It is widely used in the field of Life Sciences for research purposes. Acetylation is a post-translational modification that plays a crucial role in various cellular processes, including gene expression, protein function, and signal transduction.
CD69 antibody (Azide Free)
CD69 antibody (Azide free) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.
STK3 antibody
The STK3 antibody is a highly specialized monoclonal antibody that targets the glial fibrillary acidic protein kinase. It is widely used in the field of Life Sciences for various research purposes. This antibody specifically binds to glial fibrillary acidic protein, which is an important marker for astrocytes and glioma cells. The STK3 antibody has been extensively tested and validated for its specificity and sensitivity in detecting glial fibrillary acidic protein in various samples, including liver microsomes and tissue sections. It can be used in a wide range of applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The STK3 antibody is a valuable tool for researchers studying the role of glial fibrillary acidic protein in various cellular processes and diseases, such as Alzheimer's disease and cancer. Its high affinity and selectivity make it an ideal choice for detecting glial fibrillary acidic protein in both activated and reactive astrocytes, as
PAX3 antibody
PAX3 antibody was raised in mouse using recombinant Human Paired Box Gene 3 (Waardenburg Syndrome 1) (Pax3)
RPL3 antibody
RPL3 antibody was raised using the C terminal of RPL3 corresponding to a region with amino acids YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY
PRKAR1B antibody
PRKAR1B antibody was raised using the middle region of PRKAR1B corresponding to a region with amino acids LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT
AHCTF1 antibody
AHCTF1 antibody was raised in mouse using recombinant Human At Hook Containing Transcription Factor 1 (Ahctf1)
DCT antibody
The DCT antibody is a polyclonal antibody that specifically targets actin filaments. It is commonly used in Life Sciences research to study the activation and function of actin in various cellular processes. This antibody can be used for immunostaining, Western blotting, and other experimental techniques to visualize and quantify actin levels in cells and tissues.
CREB antibody
The CREB antibody is a highly effective tool for various applications in the field of Life Sciences. This polyclonal antibody is specifically designed to recognize and bind to the cAMP response element-binding protein (CREB), a transcription factor involved in regulating gene expression.
RAPGEF3 antibody
RAPGEF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLEAMGPDS
C16ORF65 antibody
C16ORF65 antibody was raised using the middle region of C16Orf65 corresponding to a region with amino acids TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI
C1ORF131 antibody
C1ORF131 antibody was raised using the middle region of C1Orf131 corresponding to a region with amino acids TGPEILAAAVPPSSLKNNREQVEVVEFHSNKKRKLTPDHNKNTKQANPSV
STAT6 antibody
The STAT6 antibody is a specific antibody that binds to the receptor of STAT6, a growth factor involved in various cellular processes. This antibody is designed to recognize and bind to the specific disulfide bond on the STAT6 receptor, blocking its activity and preventing downstream signaling. The STAT6 antibody is a monoclonal antibody derived from human protein and has been extensively tested for its efficacy and specificity. It forms dimers with other antibodies, such as afatinib, to enhance its cytotoxic effects. In Life Sciences research, the STAT6 antibody is commonly used for immunohistochemistry, Western blotting, and hybridization studies. It can also be used in diagnostic applications to detect the presence of alpha-msh or other related proteins. Additionally, polyclonal antibodies can be generated using the STAT6 antibody as an antigen for immunization. These polyclonal antibodies are valuable tools for studying the role of STAT6 in various biological processes.
THOC3 antibody
THOC3 antibody was raised using the middle region of THOC3 corresponding to a region with amino acids LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND
Lipase J antibody
Lipase J antibody was raised using the C terminal of LIPJ corresponding to a region with amino acids LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI
GPR88 antibody
GPR88 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purezza:Min. 95%PAR4 antibody
The PAR4 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Protease-Activated Receptor 4 (PAR4) in various biological processes. PAR4 plays a crucial role in cellular signaling pathways, particularly those involving epidermal growth factors and growth factors. By binding to PAR4, this antibody effectively inhibits its activation by proteases, preventing downstream effects such as the release of inflammatory cytokines and interferons.
CD19 antibody (FITC)
CD19 antibody (FITC) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.
Purezza:Min. 95%HMGCLL1 antibody
HMGCLL1 antibody was raised using the N terminal of HMGCLL1 corresponding to a region with amino acids MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI
TBC1D21 antibody
TBC1D21 antibody was raised using the N terminal of TBC1D21 corresponding to a region with amino acids MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFIC
AKR1C2 antibody
AKR1C2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK
Alpha-fetoprotein antibody
Alpha-fetoprotein antibody is a monoclonal antibody that inhibits the activity of alpha-fetoprotein (AFP), a protein kinase involved in various biological processes. This antibody has been shown to neutralize the superoxide produced by AFP, thereby reducing its inhibitory effect on polymers and other enzymes. In addition, alpha-fetoprotein antibody has demonstrated anticancer activity by suppressing the growth and proliferation of cancer cells. This antibody is widely used in life sciences research and has potential applications in the development of targeted therapies for various diseases, including cancer. Furthermore, it has been found to have an inhibitory effect on collagen synthesis and may have implications for tissue repair and wound healing. With its unique properties and broad range of applications, alpha-fetoprotein antibody is an essential tool for scientists and researchers in the field of antibodies and molecular biology.
Lck antibody
The Lck antibody is a highly specific monoclonal antibody that targets the Lck protein, a tyrosine kinase involved in T-cell signaling. It is commonly used in research and diagnostic applications to study the role of Lck in various cellular processes. The Lck antibody recognizes a specific epitope on the Lck protein and can be used for immunoprecipitation, Western blotting, flow cytometry, and immunofluorescence experiments. This antibody has been extensively validated and shown to have high specificity and sensitivity. It is available as both a monoclonal antibody and a polyclonal antibody, allowing researchers to choose the best option for their specific needs. Whether you are studying T-cell activation, immune response, or signal transduction pathways, the Lck antibody is an essential tool for your research. Trust in its quality and reliability to advance your understanding of cellular biology.
PDE7B antibody
PDE7B antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purezza:Min. 95%ZC3H14 antibody
ZC3H14 antibody was raised using the N terminal of ZC3H14 corresponding to a region with amino acids KFPSPPLPIFLPPEPVDLGSITSSSCSLNELDNISHLLRKISADINEIKG
p70S6 Kinase antibody
The p70S6 Kinase antibody is a powerful tool used in scientific research to study various cellular processes. This antibody specifically targets and binds to p70S6 Kinase, a protein involved in cell growth and proliferation. By binding to this protein, the antibody allows researchers to visualize and analyze its activity within cells.
Purezza:Min. 95%CD94 antibody (biotin)
CD94 antibody (biotin) was raised in rat using CHO cells transfected with the B6 allele of CD94 as the immunogen.
Purezza:Min. 95%TNF Receptor 1 antibody
TNF Receptor 1 antibody is a highly effective monoclonal antibody used in the field of Life Sciences. It is specifically designed to neutralize the activity of TNF receptor 1, a cell surface protein involved in various cellular processes. This antibody acts as a potent inhibitor of TNF receptor 1 signaling, which plays a crucial role in inflammation and immune response. The TNF Receptor 1 antibody has been extensively studied and proven to be effective in inhibiting the growth factor-induced activation of downstream pathways. It has also shown promising results in preclinical studies targeting diseases such as cancer and autoimmune disorders. With its high specificity and cytotoxic properties, this antibody holds great potential for therapeutic applications in targeted therapy. Whether used alone or in combination with other antibodies such as anti-VEGF or tyrosinase inhibitors, TNF Receptor 1 antibody offers a promising avenue for researchers and clinicians alike in their quest to combat various diseases effectively.
CD154 antibody (PE)
CD154 antibody (FITC) was raised in hamster using activated murine Th1 clone D1.6 as the immunogen.
Purezza:Min. 95%Peso molecolare:0 g/molMCL1 antibody
The MCL1 antibody is a glycoprotein that plays a crucial role in cell survival and apoptosis regulation. It is involved in the binding of activated Bcl-2 family proteins, which control the intrinsic pathway of apoptosis. This antibody is commonly used in various assays and research studies to detect and quantify MCL1 expression levels.
JAK2 antibody
The JAK2 antibody is a highly specialized monoclonal antibody that targets the Janus kinase 2 (JAK2) protein. This protein plays a crucial role in cellular signaling pathways, specifically in the regulation of cytokine receptors. By binding to JAK2, this antibody effectively inhibits its activity and prevents downstream signaling events.
Rad17 antibody (Ser645)
Synthetic human phosphopeptide (Ser645) region immunogen; rabbit polyclonal Rad17 antibody (Ser645)
ODF2 antibody
ODF2 antibody was raised using the N terminal of ODF2 corresponding to a region with amino acids MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKG
FKBPL antibody
The FKBPL antibody is a high-quality polyclonal antibody that is colloidal in nature. It specifically targets the thioredoxin interacting protein (FKBPL) and forms a strong disulfide bond with it. This antibody is widely used in life sciences research for various applications, including the study of reactive growth factors and biomolecules. It can also be used as a drug antibody or diagnostic reagent due to its high specificity and affinity for FKBPL. Additionally, this antibody has shown promising results in collagen-related research and can be used in electrode-based assays. For researchers looking for a reliable monoclonal antibody, the FKBPL antibody is an excellent choice. Its effectiveness against TGF-beta makes it an essential tool for studying this important signaling pathway.
PDGFR beta antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds known for their bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its effectiveness has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.
TARS antibody
TARS antibody was raised using the N terminal of TARS corresponding to a region with amino acids PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT
Keratin 5 antibody
The Keratin 5 antibody is a powerful tool for researchers in the field of Life Sciences. It is a monoclonal antibody that specifically targets Keratin 5, a protein found in mesenchymal stem cells. This antibody can be used to study the growth factor emission and differentiation of these cells. It has been extensively validated for use in various applications, including immunohistochemistry, western blotting, and flow cytometry.
CD117 antibody
The CD117 antibody is a monoclonal antibody that specifically targets the CD117 protein, also known as c-Kit. This protein is a receptor tyrosine kinase that plays a crucial role in the activation of endogenous hematopoietic stem cells. The CD117 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of CD117.
ARAF antibody
The ARAF antibody is a peptide receptor that is widely used in Life Sciences. It is available as both monoclonal and polyclonal antibodies, making it a versatile tool for researchers. This antibody specifically targets the ARAF protein, which plays a crucial role in various cellular processes. The ARAF antibody can be used as a diagnostic reagent to detect the expression of ARAF in different cell types or tissues. Additionally, it has been shown to be effective in studying tumor-related macrophages and their interactions with hematopoietic cells. The ARAF antibody is also useful for studying the extracellular environment and its impact on cellular behavior. Whether you are conducting research in cancer biology, immunology, or other fields, the ARAF antibody is an essential tool for investigating cellular signaling pathways and understanding disease mechanisms.
YB1 antibody
The YB1 antibody is a highly specialized monoclonal antibody that targets the cannabinoid receptor. It has been extensively studied for its potential therapeutic applications in various fields, including antiviral treatments and cancer research. The YB1 antibody has shown promising results in neutralizing the effects of certain viruses by inhibiting their replication and entry into host cells. Additionally, it has been found to have potent antitumor properties, particularly in breast cancer (MCF-7) and mesenchymal stem cells. This antibody also plays a crucial role in regulating cellular processes such as protein synthesis and phosphatase activity. Its unique binding affinity to specific receptors, such as P2X receptors, makes it an invaluable tool for studying their functions and developing targeted therapies. With its diverse range of applications and exceptional specificity, the YB1 antibody is a valuable asset for researchers in various scientific disciplines.
YEATS4 antibody
YEATS4 antibody was raised in mouse using recombinant Human Yeats Domain Containing 4 (Yeats4)
CD3 zeta antibody
The CD3 zeta antibody is a polyclonal antibody that has various applications in the field of Life Sciences. It is commonly used for research purposes, particularly in the study of antiviral responses and immune regulation. The CD3 zeta antibody has been shown to neutralize the effects of certain viruses, such as botulinum, by blocking their entry into host cells. Additionally, it has been found to modulate the activity of TGF-beta, a cytokine involved in immune cell function and inflammation. In addition to its antiviral properties, the CD3 zeta antibody has also been studied for its potential role in cancer therapy. Studies have demonstrated that this antibody can activate phosphatase enzymes and inhibit the growth of cancer cells, including MCF-7 breast cancer cells. Furthermore, it has been suggested that the CD3 zeta antibody may interact with P2X receptors and cannabinoid receptors, potentially influencing cellular signaling pathways. Overall, this versatile antibody holds promise for a wide
CD29 antibody
CD29 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purezza:Min. 95%RUNX2 antibody
RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM
