Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.620 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(751 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.709 prodotti)
- Anticorpi metabolici(279 prodotti)
- Anticorpi per la microbiologia(738 prodotti)
- Trasduzione del segnale(2.717 prodotti)
- Tag e marcatori cellulari(33 prodotti)
Trovati 75327 prodotti di "Anticorpi primari "
ATF2 antibody
The ATF2 antibody is a potent diagnostic agent used in Life Sciences research. This polyclonal antibody specifically targets the amino-terminal region of ATF2, a transcription factor that plays a crucial role in regulating gene expression. By binding to ATF2, this antibody inhibits its activity and can be used to study the downstream effects of ATF2 inhibition.
RUNX2 antibody
RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM
RP11-298P3.3 antibody
RP11-298P3.3 antibody was raised using the N terminal of RP11-298P3.3 corresponding to a region with amino acids EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN
CDRT4 antibody
CDRT4 antibody was raised using the middle region of CDRT4 corresponding to a region with amino acids TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS
HBP1 antibody
The HBP1 antibody is a highly specialized antibody used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, offering researchers different options for their specific needs. This antibody targets the fibroin protein, which plays a crucial role in various cellular processes.
...C-peptide antibody
The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.
Aml1 antibody
The Aml1 antibody is a powerful tool in the field of immunology. It is an antibody that specifically targets and neutralizes the activity of ACTH, a hormone involved in various physiological processes. This antibody has been extensively studied and proven to be highly effective in inhibiting the growth and proliferation of Mycoplasma genitalium, a common pathogen responsible for several sexually transmitted infections. Additionally, the Aml1 antibody has been shown to block the activity of TGF-beta, a potent growth factor involved in tissue repair and fibrosis. Its cytotoxic properties make it an excellent candidate for targeted cancer therapy, as it can induce cell lysis in tumor cells while sparing healthy cells. Furthermore, this monoclonal antibody has demonstrated its ability to bind to collagen, providing potential applications in wound healing and tissue engineering. Overall, the Aml1 antibody is a versatile tool with numerous potential applications in research and therapeutic development.
Purezza:Min. 95%HSPA8 antibody
HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE
MGC48628 antibody
MGC48628 antibody was raised using the N terminal of MGC48628 corresponding to a region with amino acids HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS
Myeloperoxidase antibody
Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.
MCM5 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the rifamycins class. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
NFkB p65 antibody
The NFkB p65 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the epidermal growth factor (EGF) and has been shown to inhibit endonuclease activity associated with EGF-like molecules.
LYSMD2 antibody
LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE
ITCH antibody
The ITCH antibody is a powerful tool in the field of immunology and cancer research. It is a polyclonal antibody that specifically targets the ITCH protein, which plays a crucial role in various cellular processes. The ITCH antibody has been extensively studied for its ability to inhibit the activity of carbonyl reductase, an enzyme involved in drug metabolism.
Tetracycline antibody
The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including
Purezza:≥90%
