CymitQuimica logo
Anticorpi primari

Anticorpi primari

Gli anticorpi primari sono immunoglobuline che si legano specificamente a un antigene di interesse, consentendo la rilevazione e quantificazione di proteine, peptidi o altre biomolecole. Questi anticorpi sono strumenti fondamentali in un'ampia gamma di applicazioni, tra cui Western blot, immunoistochimica ed ELISA. Presso CymitQuimica, offriamo una vasta selezione di anticorpi primari di alta qualità, che garantiscono specificità e sensibilità per vari bisogni di ricerca, tra cui studi su cancro, immunologia e biologia cellulare.

Sottocategorie di "Anticorpi primari "

Mostrare 1 più sottocategorie

Trovati 75327 prodotti di "Anticorpi primari "

Ordinare per

Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
prodotti per pagina.
  • ATF2 antibody


    The ATF2 antibody is a potent diagnostic agent used in Life Sciences research. This polyclonal antibody specifically targets the amino-terminal region of ATF2, a transcription factor that plays a crucial role in regulating gene expression. By binding to ATF2, this antibody inhibits its activity and can be used to study the downstream effects of ATF2 inhibition.

    Ref: 3D-70R-37473

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • Myc antibody (Ser62)


    Rabbit Polyclonal Myc antibody (Ser62)

    Ref: 3D-70R-37360

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • RUNX2 antibody


    RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids  DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM

    Ref: 3D-70R-1010

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • eIF2 alpha antibody (Ser51)


    Rabbit Polyclonal eIF2 alpha antibody (Ser51)

    Ref: 3D-70R-37335

    1u
    Fuori produzione
    100µg
    Fuori produzione
    Prodotto fuori produzione
  • ARMX3 antibody


    Rabbit polyclonal ARMX3 antibody

    Ref: 3D-70R-32188

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • Bcr antibody (Tyr177)


    Rabbit Polyclonal Bcr antibody (Tyr177)

    Ref: 3D-70R-37269

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • RP11-298P3.3 antibody


    RP11-298P3.3 antibody was raised using the N terminal of RP11-298P3.3 corresponding to a region with amino acids EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN

    Ref: 3D-70R-4036

    1u
    Fuori produzione
    100µl
    Fuori produzione
    Prodotto fuori produzione
  • CDRT4 antibody


    CDRT4 antibody was raised using the middle region of CDRT4 corresponding to a region with amino acids TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS

    Ref: 3D-70R-3796

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • HBP1 antibody


    The HBP1 antibody is a highly specialized antibody used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, offering researchers different options for their specific needs. This antibody targets the fibroin protein, which plays a crucial role in various cellular processes.

    Ref: 3D-70R-33720

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • ...C-peptide antibody


    The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.

    Ref: 3D-10-2246

    1mg
    Fuori produzione
    Prodotto fuori produzione
  • Aml1 antibody


    The Aml1 antibody is a powerful tool in the field of immunology. It is an antibody that specifically targets and neutralizes the activity of ACTH, a hormone involved in various physiological processes. This antibody has been extensively studied and proven to be highly effective in inhibiting the growth and proliferation of Mycoplasma genitalium, a common pathogen responsible for several sexually transmitted infections. Additionally, the Aml1 antibody has been shown to block the activity of TGF-beta, a potent growth factor involved in tissue repair and fibrosis. Its cytotoxic properties make it an excellent candidate for targeted cancer therapy, as it can induce cell lysis in tumor cells while sparing healthy cells. Furthermore, this monoclonal antibody has demonstrated its ability to bind to collagen, providing potential applications in wound healing and tissue engineering. Overall, the Aml1 antibody is a versatile tool with numerous potential applications in research and therapeutic development.

    Purezza:Min. 95%

    Ref: 3D-20R-2708

    50µg
    Fuori produzione
    Prodotto fuori produzione
  • ERH antibody (biotin)


    Rabbit polyclonal ERH antibody (biotin)

    Ref: 3D-60R-1768

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • HSPA8 antibody


    HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE

    Ref: 3D-70R-4109

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • ATP5H antibody


    Rabbit Polyclonal ATP5H antibody

    Ref: 3D-70R-36639

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • MGC48628 antibody


    MGC48628 antibody was raised using the N terminal of MGC48628 corresponding to a region with amino acids HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFS

    Ref: 3D-70R-3620

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • RSU1 antibody


    Rabbit polyclonal RSU1 antibody

    Ref: 3D-70R-20032

    1u
    Fuori produzione
    50µl
    Fuori produzione
    Prodotto fuori produzione
  • RSPH3 antibody


    Rabbit polyclonal RSPH3 antibody

    Ref: 3D-70R-20030

    ne
    Fuori produzione
    50µl
    Fuori produzione
    Prodotto fuori produzione
  • Myeloperoxidase antibody


    Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.

    Ref: 3D-10-M92A

    1u
    Fuori produzione
    1mg
    Fuori produzione
    Prodotto fuori produzione
  • MCM5 antibody


    The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug from the rifamycins class. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive studies have shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

    Ref: 3D-70R-31272

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • NFkB p65 antibody


    The NFkB p65 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the epidermal growth factor (EGF) and has been shown to inhibit endonuclease activity associated with EGF-like molecules.

    Ref: 3D-70R-37452

    1u
    Fuori produzione
    100µg
    Fuori produzione
    Prodotto fuori produzione
  • LYSMD2 antibody


    LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE

    Ref: 3D-70R-4425

    100µl
    Fuori produzione
    Prodotto fuori produzione
  • FLT3 antibody (Tyr599)


    Rabbit Polyclonal FLT3 antibody (Tyr599)

    Ref: 3D-70R-36691

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • NFKP p65 antibody (Ser311)


    Rabbit polyclonal NFKP p65 antibody (Ser311)

    Ref: 3D-70R-34294

    1u
    Fuori produzione
    100µg
    Fuori produzione
    Prodotto fuori produzione
  • ITCH antibody


    The ITCH antibody is a powerful tool in the field of immunology and cancer research. It is a polyclonal antibody that specifically targets the ITCH protein, which plays a crucial role in various cellular processes. The ITCH antibody has been extensively studied for its ability to inhibit the activity of carbonyl reductase, an enzyme involved in drug metabolism.

    Ref: 3D-70R-34428

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • GLPK2 antibody


    Rabbit polyclonal GLPK2 antibody

    Ref: 3D-70R-31884

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • ADD1 antibody (Ser726)


    Rabbit Polyclonal ADD1 antibody (Ser726)

    Ref: 3D-70R-37256

    100µg
    Fuori produzione
    Prodotto fuori produzione
  • Tetracycline antibody


    The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including

    Purezza:≥90%

    Ref: 3D-10-1704

    ne
    Fuori produzione
    1mg
    Fuori produzione
    Prodotto fuori produzione