Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.620 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(751 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.709 prodotti)
- Anticorpi metabolici(279 prodotti)
- Anticorpi per la microbiologia(738 prodotti)
- Trasduzione del segnale(2.717 prodotti)
- Tag e marcatori cellulari(33 prodotti)
Trovati 75327 prodotti di "Anticorpi primari "
RAB40A antibody
RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR
Purezza:Min. 95%HSF1 antibody
The HSF1 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes arginase, an enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be highly effective in blocking the activity of arginase, allowing researchers to investigate its role in different biological systems.
Purezza:Min. 95%GPR20 antibody
GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purezza:Min. 95%LXN antibody
The LXN antibody is a monoclonal antibody that is used to detect and study angiogenic factors. It can be used in various research applications, including immunohistochemistry and Western blotting. The LXN antibody specifically recognizes and binds to a target protein, allowing for the detection and analysis of its expression levels. This antibody has been shown to inhibit syncytia formation and block the activity of certain growth factors. Additionally, it has been found to have cholinergic activity and can modulate the function of nucleotide molecules. The LXN antibody is available as a ready-to-use solution and can be easily incorporated into experimental protocols.
Endostatin antibody
Endostatin antibody was raised in rabbit using highly pure recombinant human endostatin as the immunogen.Purezza:Min. 95%RAB32 antibody
The RAB32 antibody is a monoclonal antibody that targets the RAB32 protein. This protein plays a crucial role in various cellular processes, including the regulation of superoxide production and growth factor signaling. The RAB32 antibody has been shown to effectively neutralize the activity of RAB32, making it a valuable tool for researchers in the field of Life Sciences.
ME1 antibody
ME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL
Complement C2 antibody
Complement C2 antibody was raised using the N terminal of C2 corresponding to a region with amino acids EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS
Purezza:Min. 95%ALPK1 antibody
The ALPK1 antibody is a highly specific monoclonal antibody that targets the ALPK1 protein. This protein plays a crucial role in various cellular processes, including oncostatin signaling and β-catenin activation. The ALPK1 antibody has been extensively tested and validated for its specificity, ensuring accurate and reliable results in experiments.
HTRA4 antibody
HTRA4 antibody was raised using the middle region of HTRA4 corresponding to a region with amino acids LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTDPurezza:Min. 95%Bin1 antibody
Bin1 antibody was raised in rabbit using the N terminal of Bin1 as the immunogen
Purezza:Min. 95%Ribophorin II antibody
Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP
Purezza:Min. 95%NUSAP1 antibody
NUSAP1 antibody was raised using the C terminal of NUSAP1 corresponding to a region with amino acids LKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ
PPIE antibody
PPIE antibody was raised using a synthetic peptide corresponding to a region with amino acids KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP
Cat IgG Purified
The purified Cat IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.
ATP6V0D2 antibody
ATP6V0D2 antibody was raised using the middle region of ATP6V0D2 corresponding to a region with amino acids GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
RAB39A antibody
The RAB39A antibody is a highly effective tool used in various research and diagnostic applications. This antibody specifically targets β-catenin, an important protein involved in cell adhesion and signaling pathways. It is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs.
HAV VP1 antibody
HAV VP1 antibody is a monoclonal antibody that specifically targets the HAV VP1 protein. This antibody can be used in various applications, including immunoassays and protein detection. The HAV VP1 antibody is highly specific and exhibits strong binding affinity to the target protein, ensuring accurate and reliable results.
HRB antibody
HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN
LGALS14 antibody
LGALS14 antibody was raised using the N terminal of LGALS14 corresponding to a region with amino acids MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI
EEF2 antibody
The EEF2 antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It binds to and detects the eukaryotic elongation factor 2 (EEF2) protein, which plays a crucial role in protein synthesis. This antibody has been extensively validated for various applications, including immunohistochemistry, western blotting, and flow cytometry.
BclxL antibody
The BclxL antibody is a monoclonal antibody that belongs to the class of anti-acth antibodies. It is widely used in Life Sciences research for its ability to detect and target the BclxL protein, a key regulator of apoptosis. This antibody has been shown to exhibit cytotoxic activity against cancer cells by inducing apoptosis through the inhibition of BclxL function. Additionally, it has been found to have inhibitory effects on chemokine and TGF-beta signaling pathways, which play crucial roles in inflammation and immune response. The BclxL antibody can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. Its high specificity and affinity make it a valuable tool for studying the role of BclxL in cell survival and growth regulation.
Tetanus toxin antibody
Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.
PSA antibody
The PSA antibody is a specific antibody that is reactive to protein carbonyls. It has been shown to be effective in ultrasensitive detection of PSA in human serum. The antibody can be used for various applications, including electrochemical impedance and carbon electrode assays. It is commonly used in Life Sciences research and is available as both monoclonal and polyclonal antibodies. The PSA antibody is highly reliable and provides accurate results for the detection of messenger RNA expression levels. It can be used in combination with aluminum hydroxide adjuvant for enhanced immune response. Trust the PSA antibody for your research needs in the field of Antibodies.
cSRC antibody
The cSRC antibody is a valuable tool in the field of Life Sciences. It is widely used as an inhibitor for 6-phosphogluconate dehydrogenase, an enzyme involved in glucose metabolism. This antibody specifically targets and binds to the phosphorylation site of cSRC, a protein kinase that plays a crucial role in cell signaling pathways.
Purezza:Min. 95%Troponin T antibody (Cardiac)
Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.Granzyme B antibody (PE)
Granzyme B antibody (PE) was raised in mouse using human granzyme B as the immunogen.
RFC5 antibody
RFC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE
Purezza:Min. 95%RAGE antibody
The RAGE antibody is a glycation-specific polyclonal antibody that targets the receptor for advanced glycation end products (RAGE). This antibody plays a crucial role in various pathological conditions, including thrombotic microangiopathy and atypical hemolytic uremic syndrome. It binds to RAGE and inhibits the interaction between RAGE and its ligands, such as advanced glycation end products (AGEs) and high mobility group box 1 (HMGB1). By blocking this interaction, the RAGE antibody can prevent the activation of downstream signaling pathways involved in inflammation and tissue damage. Additionally, this antibody has been used in research studies to investigate the role of RAGE in various diseases, including cancer and neurodegenerative disorders. The RAGE antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific experimental needs.
Purezza:Min. 95%Methamphetamine antibody
Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.
Purezza:Min. 95%ATF2 antibody
The ATF2 antibody is a highly specialized product used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications. This antibody specifically targets ATF2, a transcription factor involved in various cellular processes such as DNA repair and apoptosis.
DPY19L4 antibody
DPY19L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR
Purezza:Min. 95%Cytokeratin 10 antibody
Cytokeratin 10 antibody is a collagen-based product that is used in Life Sciences research. This antibody has antiviral properties and can be used in experiments involving electrodes. It is a monoclonal antibody that has neutralizing effects on certain growth factors. Cytokeratin 10 antibody can be used in the detection of specific proteins in human serum, such as fibrinogen, anti-mesothelin, and alpha-fetoprotein. It can also be used as an activated inhibitor in various assays and experiments. With its high specificity and effectiveness, this antibody is a valuable tool for researchers in the field of Life Sciences.
MDM1 antibody
MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE
Purezza:Min. 95%DENND1A antibody
DENND1A antibody was raised using the N terminal of DENND1A corresponding to a region with amino acids PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML
TIE1 antibody
The TIE1 antibody is a highly specific antibody that targets the TIE1 protein, which is an important receptor involved in various biological processes. This monoclonal antibody is widely used in life sciences research to study the role of TIE1 in insulin signaling, adiponectin signaling, and growth factor regulation.
SOX2 antibody
The SOX2 antibody is a highly specific and reliable tool used in immunohistochemistry and other life science research applications. This monoclonal antibody binds to the SOX2 antigen, which is a nuclear DNA-binding protein involved in the regulation of embryonic development and cell differentiation. The SOX2 antibody has been extensively validated for its performance in various experimental techniques, including electrochemical impedance spectroscopy.
Cytokeratin 17 antibody
Cytokeratin 17 antibody was raised in mouse using human cytokeratin 17 as the immunogen.
STAT3 antibody
The STAT3 antibody is a highly effective tool for researchers in the field of Life Sciences. This polyclonal antibody specifically targets the STAT3 protein, which plays a crucial role in various cellular processes such as growth factor signaling and actin filament formation. By binding to STAT3, this antibody allows researchers to study its activation and function.
Calmodulin antibody
Calmodulin antibody was raised in mouse using calmodulin purified from Dictyostelium discoideum as the immunogen.
SSBP3 antibody
SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids SNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNP
Lactoferrin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied and proven to be active using advanced techniques like the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.HIV1 antibody (HTLV3) (FITC)
HIV1 antibody (HTLV3) (FITC) was raised in goat using human isolate as the immunogen.
Keratin 19 antibody
The Keratin 19 antibody is a highly specialized monoclonal antibody that targets the growth factor Keratin 19. It is commonly used in Life Sciences research for various applications such as hybridization studies, high-affinity glucose binding assays, and polymerase chain reactions (PCR). This antibody can also be utilized in the development of polymeric micelles for drug delivery systems and as a tool in gene therapy using adeno-associated virus vectors. Additionally, the Keratin 19 antibody has been shown to play a role in preventing deprivation-induced apoptosis by targeting molecular pathways involved in cell survival. Its specificity towards Keratin 19 makes it an ideal tool for studying sugar transport mechanisms, collagen synthesis, and the effects of compounds like okadaic acid on cellular processes. With its exceptional affinity and versatility, the Keratin 19 antibody is an invaluable asset for researchers exploring a wide range of molecular targets in their scientific investigations.
APP antibody
The APP antibody is a high-quality polyclonal antibody that is used in various applications in the field of Life Sciences. It is specifically designed to target and detect amyloid precursor protein (APP), a key player in the formation of amyloid plaques associated with Alzheimer's disease.
Purezza:Min. 95%Testosterone 3 antibody
Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.
Vav antibody
The Vav antibody is a polyclonal antibody that specifically targets the Vav protein. This antibody is widely used in life sciences research to study the role of Vav in various cellular processes. The Vav protein is involved in signal transduction pathways, particularly those mediated by TGF-beta and growth factors. It plays a crucial role in regulating cell proliferation, differentiation, and apoptosis.
Purezza:Min. 95%SRY antibody
The SRY antibody is a highly specialized growth factor that has been extensively studied in the field of Life Sciences. It plays a crucial role in various biological processes, including cell proliferation, differentiation, and development. The SRY antibody has been shown to have a neutralizing effect on interferon-gamma (IFN-gamma), which is an important cytokine involved in immune responses.Sumo1 antibody
The Sumo1 antibody is a polyclonal antibody that is used for the immobilization of human serum on an electrode. It is commonly used in research and laboratory settings to study the binding proteins and inhibitors involved in various cellular processes. This antibody has also been shown to have neutralizing effects on interferon, making it a valuable tool in immunology research. Additionally, the Sumo1 antibody has demonstrated neuroprotective properties and has been investigated for its potential use in treating neurodegenerative disorders. However, it is important to note that this antibody may have teratogenic effects and should be handled with caution. In the field of Life Sciences, the Sumo1 antibody plays a crucial role in understanding cellular pathways and protein interactions.
NNMT antibody
NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC
CRP antibody
CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.
AKR1C1 antibody
The AKR1C1 antibody is a potent family kinase inhibitor that targets specific growth factors, such as glucagon and epidermal growth factor. It is a polyclonal antibody that has been developed for neutralizing the effects of these growth factors in various biological systems. The antibody is formulated with excipients to ensure stability and efficacy. It can be used in various life science applications, including research and diagnostics. Additionally, the AKR1C1 antibody can also target other proteins, such as β-catenin, chemokines, alpha-fetoprotein, and globulins. Its specificity and effectiveness make it an essential tool for studying protein-protein interactions and cellular signaling pathways.
Purezza:Min. 95%FGF2 antibody
FGF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
SARS-CoV-2 Spike Antibody
The SARS-CoV-2 Spike Antibody is a highly effective tool for immunoassays and research in the field of Life Sciences. This antibody specifically targets the spike protein of the SARS-CoV-2 virus, which is responsible for receptor binding and entry into host cells.Cip1 antibody
Cip1 antibody was raised in rabbit using residues 139-164 of the p21 protein as the immunogen.
Purezza:Min. 95%COL11A1 antibody
The COL11A1 antibody is a monoclonal antibody specifically designed for Life Sciences research. It targets the antigen binding domain of COL11A1, a protein involved in various biological processes. This antibody is highly specific and can be used in a range of applications, including assays and biomolecule detection.
Smpdl3a antibody
Smpdl3a antibody was raised in rabbit using the N terminal of Smpdl3a as the immunogen
Purezza:Min. 95%TSH beta antibody F(ab)'2 Fragment
TSH beta antibody was raised against Human TSH (intact).
Purezza:Min. 95%Goat anti Rat IgG (Fab'2) (FITC)
Goat anti-rat IgG (Fab'2) (FITC) was raised in goat using rat IgG F(c) fragment as the immunogen.
Purezza:Min. 95%PARP2 antibody
The PARP2 antibody is a cytotoxic monoclonal antibody used in Life Sciences research. It is designed to target and bind to the PARP2 protein, which plays a crucial role in DNA repair and cell survival. This antibody can be immobilized on an electrode or used in various assays to study the interaction between PARP2 and other molecules.
p73 antibody
The p73 antibody is an essential tool in the field of life sciences. It specifically targets the epidermal growth factor and acts as an endonuclease, which is crucial for DNA repair and maintenance. The p73 antibody is available in both polyclonal and monoclonal forms, providing researchers with options based on their specific needs.
Purezza:Min. 95%CKB antibody
The CKB antibody is a polyclonal antibody that specifically targets the creatine kinase B (CKB) protein. This antibody is widely used in Life Sciences research to study various cellular processes and signaling pathways. The CKB protein plays a crucial role in energy metabolism by catalyzing the reversible transfer of phosphate between ATP and creatine, thus providing a readily available source of energy for cells. It is primarily expressed in tissues with high-energy demands, such as skeletal muscle, heart, and brain.
FSH antibody
The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.
Purezza:Min. 95%...C-peptide antibody
The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.
ZHX2 antibody
The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.
Purezza:Min. 95%Mouse Isotyping Kit
Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.
Purezza:Min. 95%TL1A antibody
TL1A antibody was raised in rabbit using highly pure recombinant human TL-1A as the immunogen.
Purezza:Min. 95%Goat anti Llama IgG (H + L) (HRP)
This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.Purezza:Min. 95%PNMA3 antibody
PNMA3 antibody was raised using the N terminal of PNMA3 corresponding to a region with amino acids QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM
S6K1 antibody
The S6K1 antibody is a potent inhibitor of thrombocytopenia, which is the condition of having low platelet count. It works by blocking the action of interleukin-6, a cytokine that plays a role in platelet production. This monoclonal antibody is widely used in Life Sciences research as a tool to study the function of S6K1, a family kinase involved in cell growth and proliferation. In addition to its use as a research tool, this antibody also has potential therapeutic applications. Its inhibitory effects on S6K1 make it a promising candidate for the development of targeted therapies against diseases characterized by abnormal cell growth, such as cancer. Furthermore, it has been shown to have an impact on viscosity regulation and can modulate the activity of various growth factors and chemokines involved in tissue repair and regeneration. Whether you are studying mesenchymal stem cells or investigating the role of epidermal growth factor or collagen in certain conditions, this
Purezza:Min. 95%NR2F1 antibody
NR2F1 antibody was raised using the C terminal of NR2F1 corresponding to a region with amino acids VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP
Pneumocystis carinii antibody
Pneumocystis carinii antibody was raised in mouse using Pneumocystis carinii isolates as the immunogen.
OR13C9 antibody
OR13C9 antibody was raised in rabbit using the middle region of OR13C9 as the immunogen
Purezza:Min. 95%SMAD4 antibody
The SMAD4 antibody is a highly effective inhibitor that targets the histidine-rich region of the human serum. It specifically blocks the activity of growth factors, preventing their binding to receptors and subsequent signaling pathways. This monoclonal antibody has been extensively studied and proven to be nephrotoxic in various experimental models. Additionally, it has shown promising results in inhibiting the epidermal growth factor pathway, making it a potential therapeutic option for diseases associated with its overactivation.
CD203c antibody
CD203c antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and bind to DNA binding proteins that play a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in glycosylation studies, where it helps researchers understand the role of glycosylation in protein function and regulation.
