Anticorpi primari
Gli anticorpi primari sono immunoglobuline che si legano specificamente a un antigene di interesse, consentendo la rilevazione e quantificazione di proteine, peptidi o altre biomolecole. Questi anticorpi sono strumenti fondamentali in un'ampia gamma di applicazioni, tra cui Western blot, immunoistochimica ed ELISA. Presso CymitQuimica, offriamo una vasta selezione di anticorpi primari di alta qualità, che garantiscono specificità e sensibilità per vari bisogni di ricerca, tra cui studi su cancro, immunologia e biologia cellulare.
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.620 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(751 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.793 prodotti)
- Anticorpi metabolici(279 prodotti)
- Anticorpi per la microbiologia(736 prodotti)
- Trasduzione del segnale(2.717 prodotti)
- Tag e marcatori cellulari(33 prodotti)
Mostrare 1 più sottocategorie
Trovati 75326 prodotti di "Anticorpi primari "
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
PDIA4 antibody
<p>The PDIA4 antibody is a monoclonal antibody that targets the cell antigen PDIA4. It specifically recognizes and binds to the tyrosine residue on PDIA4, inhibiting its function. PDIA4 plays a crucial role in various cellular processes, including the regulation of interleukin-6 (IL-6) signaling. By blocking PDIA4, this antibody can modulate IL-6 activity and potentially impact inflammatory responses.</p>TUJ1 antibody
<p>TUJ1 antibody was raised in rabbit using residues 433-450 EGEMYEDDEEESEAQGPK of the 50 kDa human beta-tubulin-III protein as the immunogen.</p>Purezza:Min. 95%SOX5 antibody
<p>SOX5 antibody was raised in mouse using recombinant Human Sry (Sex Determining Region Y)-Box 5</p>RGS8 antibody
<p>RGS8 antibody was raised in rabbit using human RGS8 protein as the immunogen.</p>Purezza:Min. 95%Sbk1 antibody
<p>Sbk1 antibody was raised in rabbit using the C terminal of Sbk1 as the immunogen</p>Purezza:Min. 95%Tuberin antibody
<p>The Tuberin antibody is a highly specialized protein complex used in Life Sciences research. It is an essential tool for studying various biomolecules and their interactions. This antibody specifically targets tuberin, a protein involved in the regulation of cell growth and proliferation. By binding to tuberin, this antibody can help researchers understand the mechanisms behind diseases such as cancer and neurological disorders.</p>Plasminogen antibody
<p>Plasminogen antibody was raised in sheep using human plasminogen purified from plasma as the immunogen.</p>Survivin antibody (Thr34)
<p>Synthetic human survivin phosphopeptide (Thr34) immunogen; rabbit Polyclonal Survivin antibody (Thr34)</p>Synaptophysin antibody
<p>The Synaptophysin antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets synaptophysin, a protein that plays a crucial role in synaptic vesicle trafficking and neurotransmitter release. It is widely used in studies involving growth factors, mesenchymal stem cells, lysine emission, autoantibodies, monoclonal antibodies, and endothelial growth.</p>TNNI3K antibody
<p>TNNI3K antibody was raised using the middle region of TNNI3K corresponding to a region with amino acids PGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKRSLQY</p>FXR1 antibody
<p>FXR1 antibody was raised using the C terminal of FXR1 corresponding to a region with amino acids EQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDW</p>Ssr2 antibody
<p>Ssr2 antibody was raised in rabbit using the C terminal of Ssr2 as the immunogen</p>Purezza:Min. 95%TBCCD1 antibody
<p>TBCCD1 antibody was raised using the N terminal of TBCCD1 corresponding to a region with amino acids WPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQL</p>AKR1C2 antibody
<p>The AKR1C2 antibody is a highly specialized protein that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences and has shown significant potential in research and therapeutic applications.</p>HNRPK antibody
<p>HNRPK antibody was raised using the C terminal of HNRPK corresponding to a region with amino acids YSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS</p>CENPE Antibody
<p>The CENPE Antibody is a highly effective inhibitor and reagent that serves as a valuable biomarker in the field of Life Sciences. This monoclonal antibody is specifically designed to target and inhibit CENPE, a key protein involved in the regulation of hematopoietic and pluripotent stem cells. With its high specificity and affinity, this antibody can be used for various applications including immunohistochemical staining and detection of CENPE expression in different cell types.</p>UPF3B antibody
<p>UPF3B antibody was raised using a synthetic peptide corresponding to a region with amino acids KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA</p>LAMP3 antibody
<p>LAMP3 antibody was raised using the N terminal of LAMP3 corresponding to a region with amino acids YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT</p>Purezza:Min. 95%ZNF276 antibody
<p>ZNF276 antibody was raised in rabbit using the middle region of ZNF276 as the immunogen</p>Purezza:Min. 95%SERPINB13 antibody
<p>SERPINB13 antibody was raised in rabbit using the middle region of SERPINB13 as the immunogen</p>Purezza:Min. 95%
