Anticorpi primari

<p>F7 antibody was raised in rabbit using the middle region of F7 as the immunogen</p>

<p>Rabbit polyclonal NMUR1 antibody</p>

<p>Purified Mouse anti-SFTS Virus Antibody. Severe fever with thrombocytopenia syndrome.</p>

<p>NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR</p>

<p>Rabbit polyclonal EPHA1 antibody</p>

<p>CHRND antibody was raised in rabbit using the N terminal of CHRND as the immunogen</p>

<p>Purified Rabbit polyclonal ATP1 alpha antibody (Ser23)</p>

<p>The FAK antibody is a highly effective monoclonal antibody used in Life Sciences. It belongs to the family of antibodies targeting specific growth factors, such as trastuzumab and adalimumab. This antibody specifically targets CD33, a protein expressed on the surface of certain cells. By neutralizing CD33, the FAK antibody inhibits the growth and proliferation of these cells.</p>

<p>The NF1 antibody is a polyclonal antibody that specifically targets the NF1 protein. This protein plays a crucial role in regulating cell growth and division, as well as in controlling the development of tumors. The NF1 antibody is widely used in life sciences research to study the function and activity of the NF1 protein.</p>

<p>PGAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQVKIWRRSFDIPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDT</p>

<p>Rabbit polyclonal ERH antibody (biotin)</p>

<p>Rabbit polyclonal LMTK2 antibody</p>

<p>The JAK2 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to the Janus kinase 2 (JAK2) protein, which plays a crucial role in various cellular processes. The JAK2 antibody has been extensively studied for its ability to inhibit the activation of JAK2 and downstream signaling pathways, including the β-catenin pathway. This inhibition can have significant implications in liver microsomes, collagen synthesis, growth factor signaling, oncostatin M-induced gene expression, calmodulin-dependent kinase activity, and more.</p>

<p>The RAD9 antibody is a trifunctional antibody that plays a crucial role in various life sciences applications. It is widely used in research to study the signaling pathways of growth factors and 3-kinase enzymes. This polyclonal antibody specifically targets the RAD9 protein, which is activated in response to genotoxic stress and DNA damage. It has been shown to have neutralizing effects on amyloid proteins and can be used to detect and quantify alpha-fetoprotein levels in human serum samples. The RAD9 antibody is also commonly utilized in immunohistochemistry and Western blotting techniques, making it an essential tool for researchers studying protein kinases, chemokines, and other molecular markers. With its high specificity and sensitivity, this antibody provides reliable results for a wide range of experimental applications in the field of Life Sciences.</p>

<p>HSPA8 antibody was raised using the N terminal of HSPA8 corresponding to a region with amino acids VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE</p>

<p>Rabbit polyclonal TMCO6 antibody</p>

<p>The STAT6 antibody is a specific antibody that binds to the receptor of STAT6, a growth factor involved in various cellular processes. This antibody is designed to recognize and bind to the specific disulfide bond on the STAT6 receptor, blocking its activity and preventing downstream signaling. The STAT6 antibody is a monoclonal antibody derived from human protein and has been extensively tested for its efficacy and specificity. It forms dimers with other antibodies, such as afatinib, to enhance its cytotoxic effects. In Life Sciences research, the STAT6 antibody is commonly used for immunohistochemistry, Western blotting, and hybridization studies. It can also be used in diagnostic applications to detect the presence of alpha-msh or other related proteins. Additionally, polyclonal antibodies can be generated using the STAT6 antibody as an antigen for immunization. These polyclonal antibodies are valuable tools for studying the role of STAT6 in various biological processes.</p>

<p>AK3 antibody was raised using the N terminal of AK3 corresponding to a region with amino acids MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT</p>

<p>Mouse monoclonal BCAR1 antibody</p>

<p>Purified Polyclonal CYP11B1 antibody</p>

<p>The Elk1 antibody is a biomolecule that specifically targets the Elk1 protein, making it an essential tool in life sciences research. This polyclonal antibody recognizes the glycoprotein Elk1, which plays a crucial role in various cellular processes. It is involved in gene transcription and acts as a transcription factor that regulates the expression of genes involved in cell proliferation, differentiation, and survival.</p>

<p>WNT6 antibody was raised using the middle region of WNT6 corresponding to a region with amino acids ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG</p>

<p>OR2W1 antibody was raised in rabbit using the C terminal of OR2W1 as the immunogen</p>

<p>Rabbit polyclonal FRS2 antibody (Tyr436)</p>

<p>Purified Polyclonal PSMD6 antibody</p>

<p>Monoclonal Mouse anti-Human Cardiac Troponin I</p>