Anticorpi primari
Gli anticorpi primari sono immunoglobuline che si legano specificamente a un antigene di interesse, consentendo la rilevazione e quantificazione di proteine, peptidi o altre biomolecole. Questi anticorpi sono strumenti fondamentali in un'ampia gamma di applicazioni, tra cui Western blot, immunoistochimica ed ELISA. Presso CymitQuimica, offriamo una vasta selezione di anticorpi primari di alta qualità, che garantiscono specificità e sensibilità per vari bisogni di ricerca, tra cui studi su cancro, immunologia e biologia cellulare.
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.620 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(751 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.793 prodotti)
- Anticorpi metabolici(279 prodotti)
- Anticorpi per la microbiologia(736 prodotti)
- Trasduzione del segnale(2.717 prodotti)
- Tag e marcatori cellulari(33 prodotti)
Mostrare 1 più sottocategorie
Trovati 75326 prodotti di "Anticorpi primari "
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
ASH1L antibody
<p>ASH1L antibody was raised in mouse using recombinant Ash1 (Absent, Small, Or Homeotic)-Like (Drosophila) (Ash1L)</p>GPD1L antibody
<p>GPD1L antibody was raised using the middle region of GPD1L corresponding to a region with amino acids ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV</p>STAT5B antibody
<p>The STAT5B antibody is a highly specialized product used in the field of Life Sciences. It is designed to specifically target and inhibit the activity of STAT5B, a nuclear protein involved in various cellular processes. This antibody has been extensively tested and validated for its effectiveness in blocking the function of STAT5B.</p>INSL5 antibody
<p>INSL5 antibody was raised using the middle region of INSL5 corresponding to a region with amino acids RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK</p>DDX24 antibody
<p>DDX24 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK</p>RGS16 antibody
<p>The RGS16 antibody is a highly specialized growth factor that plays a crucial role in various biological processes. It interacts with the apical membrane of cells and facilitates the binding of antibodies to specific targets. This antibody is particularly effective in recognizing and binding to human folate, which is essential for healthy cell growth and development. Additionally, the RGS16 antibody has been found to be involved in glycosylation processes, promoting proper protein structure and function.</p>HPV18 antibody
<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>NP antibody
<p>The NP antibody is a monoclonal antibody that specifically targets antiphospholipid antibodies. It is designed to recognize and bind to glycopeptides and glycoproteins associated with these autoantibodies. The NP antibody has cytotoxic properties and can be used for various applications in research and diagnostics.</p>CD102 antibody
<p>The CD102 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets β-catenin, a protein involved in cell adhesion and signaling pathways. This antibody has been shown to be effective in detecting β-catenin expression in various tissues, including liver microsomes. Additionally, the CD102 antibody has anti-beta amyloid properties, making it useful for studying neurodegenerative diseases such as Alzheimer's. It also exhibits growth factor activity and can activate caspase-9, an enzyme involved in apoptosis. This antibody has antiviral properties and can inhibit the replication of certain viruses. The CD102 antibody is commonly used in immunoassays to detect the presence of β-catenin and can also be used to study polymerase activity and proteolytic processes. Its acidic nature allows for optimal binding to nuclear factor kappa-light-chain-enhancer regions.</p>KCNRG antibody
<p>KCNRG antibody was raised using the N terminal of KCNRG corresponding to a region with amino acids VDRDGDLFSFILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNP</p>
