Anticorpi primari

<p>ZBTB6 antibody was raised in rabbit using the N terminal of ZBTB6 as the immunogen</p>

<p>NOSIP antibody was raised in rabbit using the middle region of NOSIP as the immunogen</p>

<p>Alien antibody was raised in rabbit using Residues 239-250 [ECGGKMHLREGE] of Alien as the immunogen.</p>

<p>C18ORF25 antibody was raised using the middle region of C18Orf25 corresponding to a region with amino acids STSSSDDDEEVSGSSKTITAEIPGHLDPGFLASDKTSAGNAPLNEEINIA</p>

<p>SDS antibody was raised using the middle region of SDS corresponding to a region with amino acids KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI</p>

<p>Factor VIII antibody is a monoclonal antibody that specifically targets and neutralizes factor VIII, a serine protease involved in the blood clotting process. This antibody is a glycoprotein composed of two identical subunits, or dimers, that bind to factor VIII and prevent its activity. The binding of the antibody to factor VIII inhibits its ability to activate other proteins involved in blood clotting, thereby preventing the formation of clots. Factor VIII antibody has been used in various applications in life sciences research, including the development of diagnostic tests for clotting disorders and the investigation of factors involved in blood coagulation. Additionally, this antibody has shown cytotoxic effects on certain cell types, making it a potential candidate for targeted therapy in certain diseases.</p>

<p>Rabbit polyclonal OR13C2 antibody</p>

<p>Mouse monoclonal HIV1 gp41 antibody (biotin); Neat Serum with no preservatives.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Extensive studies have shown its high efficacy in human erythrocytes using a patch-clamp technique.</p>

<p>ARPC2 antibody was raised in Rabbit using Human ARPC2 as the immunogen</p>

<p>The PDCD4 antibody is a highly specialized antibody that targets the protein phosphatase 2A (PP2A), which plays a crucial role in regulating cellular processes such as cell growth, proliferation, and apoptosis. This antibody is available in both polyclonal and monoclonal forms, allowing for flexibility in experimental design.</p>

<p>The MARCKS antibody is a genotoxic glycopeptide that is used in Life Sciences research. It is a monoclonal antibody that specifically targets the MARCKS protein. This protein plays a crucial role in cellular processes such as cell adhesion, migration, and signaling. The MARCKS antibody can be used to study the function and regulation of this protein in various biological systems.</p>

<p>ACOT11 antibody was raised using the middle region of ACOT11 corresponding to a region with amino acids AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL</p>

<p>EIF5A2 antibody was raised using the N terminal of EIF5A2 corresponding to a region with amino acids MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK</p>

<p>CYP2A7 antibody was raised using the N terminal of CYP2A7 corresponding to a region with amino acids MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN</p>

<p>SELS antibody was raised using the middle region of SELS corresponding to a region with amino acids PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS</p>

<p>Rabbit polyclonal PFDN5 antibody</p>

<p>Cytokeratin 5 antibody is a high-quality monoclonal antibody that specifically targets the apical membrane protein phosphatase. It plays a crucial role in regulating cell growth and differentiation by binding to tyrosine residues on epidermal growth factor receptors. This antibody is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>Tektin 4 antibody was raised using the N terminal of TEKT4 corresponding to a region with amino acids LATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLA</p>

<p>Purified Polyclonal FXR2 antibody</p>

<p>Purified Polyclonal SHPTP2 antibody</p>

<p>The JAK2 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to the Janus kinase 2 (JAK2) protein, which plays a crucial role in various cellular processes. The JAK2 antibody has been extensively studied for its ability to inhibit the activation of JAK2 and downstream signaling pathways, including the β-catenin pathway. This inhibition can have significant implications in liver microsomes, collagen synthesis, growth factor signaling, oncostatin M-induced gene expression, calmodulin-dependent kinase activity, and more.</p>

<p>Purified Polyclonal CHRNA10 antibody</p>

<p>EIF4G3 antibody was raised using the N terminal of EIF4G3 corresponding to a region with amino acids TAASDQKQEEKPKPDPVLKSPSPVLRLVLSGEKKEQEGQTSETTAIVSIA</p>

<p>The STAT3 antibody is a peptide antigen used in Life Sciences research. It is commonly used in studies involving the expression plasmid and antibodies. This antibody specifically targets the inhibitory factor of the cytokine family, interleukin-6, and has been shown to inhibit the activation of reactive glial fibrillary acidic cells. The STAT3 antibody can be used in various experimental techniques, such as immunohistochemistry and Western blotting. Its high specificity and affinity make it an ideal tool for researchers studying cell signaling pathways and inflammatory responses. With its wide range of applications, this polyclonal antibody is a valuable asset for any laboratory or research facility.</p>

<p>Purified Mouse anti-Cat IgE Antibody</p>