Anticorpi primari

COL1A1 antibody is a monoclonal antibody that specifically targets the COL1A1 protein. It binds to the apical membrane of cells and can be used for various applications in life sciences research. This antibody has been extensively studied and validated for its specificity and sensitivity. It is commonly used in immunohistochemistry, immunofluorescence, and Western blotting experiments. The COL1A1 antibody can also be used in diagnostic assays to detect the presence of autoantibodies or as a therapeutic agent in pharmaceutical preparations. Additionally, this antibody has shown potential antiviral properties and can inhibit the growth factor signaling pathway, making it a versatile tool for researchers in various fields.

Rabbit anti Mouse IgM is a monoclonal antibody that belongs to the category of antibodies. It is specifically designed to target and bind to mouse IgM, making it an essential tool for various research applications in the field of Life Sciences. This antibody can be used for studying the role of IgM in different biological processes such as anti-VEGF (vascular endothelial growth factor) therapy, adiponectin signaling, β-catenin regulation, and more. Additionally, Rabbit anti Mouse IgM can be utilized for detecting specific proteins like human chorionic gonadotropin (hCG), alpha-synuclein, epidermal growth factor (EGF), c-myc, and glycopeptides. Its binding ability allows researchers to explore these proteins' functions and interactions within cellular pathways. Furthermore, this antibody has been shown to induce Fas-mediated apoptosis in certain experimental settings. With its high specificity and versatility, Rabbit anti Mouse IgM is an invaluable tool for advancing scientific

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

The BMP10 antibody is a highly specialized monoclonal antibody that targets mesothelin, a protein expressed in various cancers such as pancreatic, ovarian, and lung cancer. This antibody has been shown to inhibit the growth of amyloid plaques associated with Alzheimer's disease and reduce the expression of osteopontin, a protein involved in tumor progression. The BMP10 antibody can be used in various life science research applications, including immunohistochemistry, western blotting, and flow cytometry. It has also been shown to modulate the activity of β-catenin and oncostatin M signaling pathways. With its high specificity and affinity for mesothelin, this antibody is a valuable tool for studying cancer biology and developing targeted therapies.

The ADAR1 antibody is a reactive growth factor that is commonly used in Life Sciences research. It has the ability to bind to lipoprotein lipase and serum albumin, forming a disulfide bond. This specific monoclonal antibody is highly effective in detecting autoantibodies and can be used for various applications in research and diagnostics. Additionally, it has shown binding affinity towards cations and anti-thyroglobulin antibodies. With its high specificity and sensitivity, the ADAR1 antibody is an essential tool for studying protein-protein interactions and understanding disease mechanisms.

Affinity purified Rabbit polyclonal IL17 Receptor C antibody

KIAA0859 antibody was raised using the C terminal of KIAA0859 corresponding to a region with amino acids NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV

PTGES antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

MDFIC antibody was raised in rabbit using the N terminal of MDFIC as the immunogen

The POU2F2 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the chemokine POU2F2 and can be used for various applications such as immunohistochemistry and Western blotting. This antibody has been shown to neutralize the activity of POU2F2, preventing its interaction with other molecules and inhibiting its function. Additionally, it can be used as a cross-linking agent in experiments involving colloidal antigen-antibody complexes. The POU2F2 antibody has high affinity and specificity, allowing for accurate detection and analysis of POU2F2 in samples. Its activated form has been shown to effectively lyse cells expressing high levels of tumor necrosis factor-alpha (TNF-α) receptors, making it a valuable tool for studying TNF-α signaling pathways.

Rabbit polyclonal SPTBN1 antibody

Affinity purified Rabbit polyclonal HSD11B1 antibody

Mouse monoclonal RTN4IP1 antibody

Rabbit polyclonal SLC4A8 antibody

Rabbit polyclonal TEX13A antibody

GRIN1 antibody was raised in Rabbit using Human GRIN1 as the immunogen

Rabbit polyclonal ST5 antibody

ATP5D antibody was raised in Rabbit using Human ATP5D as the immunogen

Affinity purified Rabbit polyclonal BRE antibody