Anticorpi primari
Sottocategorie di "Anticorpi primari "
- Ricerca sul cancro Anticorpi(3.620 prodotti)
- Anticorpi cardiovascolari(2 prodotti)
- Biologia dello sviluppo(751 prodotti)
- Anticorpi epigenetici(162 prodotti)
- Anticorpi per l’immunologia(2.551 prodotti)
- Anticorpi metabolici(279 prodotti)
- Anticorpi per la microbiologia(739 prodotti)
- Trasduzione del segnale(2.717 prodotti)
- Tag e marcatori cellulari(33 prodotti)
Trovati 75447 prodotti di "Anticorpi primari "
Caspase 9 antibody
The Caspase 9 antibody is a polyclonal antibody that specifically targets the caspase-9 protein. This antibody has been shown to have neutralizing properties and can effectively inhibit the activity of caspase-9. Caspase-9 plays a crucial role in apoptosis, or programmed cell death, by initiating the cascade of events that lead to cell death. By targeting caspase-9, this antibody can help regulate cell growth and survival.
CD4 antibody
The CD4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as an inhibitor, targeting coagulation factors and other active agents involved in various biological processes. This monoclonal antibody specifically binds to nuclear antigens, making it an effective tool for research and diagnostic purposes.
SAR1B antibody
SAR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ
ZNF660 antibody
ZNF660 antibody was raised in rabbit using the C terminal of ZNF660 as the immunogen
Purezza:Min. 95%HISPPD1 antibody
HISPPD1 antibody was raised using the middle region of HISPPD1 corresponding to a region with amino acids SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV
TSH beta antibody F(ab)'2 Fragment
TSH beta antibody was raised against Human TSH (intact).
Purezza:Min. 95%IL4 antibody
The IL4 antibody is a multidrug that targets specific proteins in the body. It has been shown to have a significant impact on human hepatocytes, inhibiting the production of alpha-fetoprotein and anti-glial fibrillary acidic protein. This antibody is part of a class of chimeric proteins known as polyclonal antibodies, which are widely used in Life Sciences research. The IL4 antibody also acts as an inhibitor, blocking the activity of certain enzymes and molecules involved in various biological processes. It is commonly conjugated with biotinylation and can be easily detected using streptavidin-based detection systems. With its high specificity and affinity, the IL4 antibody offers great potential for therapeutic applications and further scientific investigations.
THBS2 antibody
The THBS2 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to CD33, a receptor protein involved in various biological processes. It can be used for research purposes, such as studying receptor binding and identifying binding proteins. Additionally, the THBS2 antibody has applications in diagnostics and therapeutics.
Influenza Virus Ns1A Binding Protein antibody
Influenza Virus Ns1A Binding Protein antibody was raised using the N terminal of IVNS1ABP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK
Factor VII antibody (FITC)
Factor VII antibody (FITC) was raised in sheep using human Factor VII purified from plasma as the immunogen.SNRP70 antibody
SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK
