Anticorpi primari

The TAF1 antibody is a powerful tool in the field of Life Sciences. It specifically targets and neutralizes the endonuclease activity of TAF1, an enzyme involved in various cellular processes such as carbonic and glutamate metabolism, growth factor signaling, and histidine biosynthesis. This monoclonal antibody has been extensively tested and proven to effectively inhibit TAF1's hyaluronidase activity, which is crucial for tissue remodeling and cell migration. Additionally, it has been shown to reduce microvessel density in tumor models, making it a potential therapeutic option for angiogenesis-related disorders. With its high specificity and affinity, the TAF1 antibody is an invaluable asset for researchers in need of reliable tools to study TAF1 function and its implications in various biological processes.

The Villin antibody is a highly effective and versatile tool in the field of biomedical research. This colloidal antibody specifically targets β-catenin, a key regulator of cell growth and development. By neutralizing β-catenin activity, this monoclonal antibody can inhibit the signaling pathways associated with epidermal growth factor (EGF) and interleukins, which play crucial roles in cellular processes such as proliferation and differentiation.

The SDHB antibody is a highly effective neutralizing monoclonal antibody that targets a specific growth factor. It is colloidal in nature and has been extensively studied for its therapeutic potential. This antibody binds to a specific antigen, preventing it from interacting with its receptor and inhibiting the downstream signaling pathway. The SDHB antibody has also been shown to have neurotrophic and neuroprotective effects, making it a promising candidate for the treatment of neurological disorders. Additionally, this antibody has been used in research settings to detect the presence of certain proteins, such as the circumsporozoite protein. Its high specificity and sensitivity make it a valuable tool for various applications in both academic and industrial settings.

Affinity purified Rabbit polyclonal STRA8 antibody

KIF20A antibody was raised in Rabbit using Human KIF20A as the immunogen

Rat monoclonal CD45R antibody (FITC)

CD4 antibody (FITC) was raised in mouse using human CD4 as the immunoge.

Affinity purified Rabbit polyclonal Copine 3 antibody

Goat anti-rabbit IgG (H + L) (FITC) was raised in goat using rabbit IgG, (H&L) as the immunogen.

The HA antibody is a high-quality polyclonal antibody that is widely used in life sciences research. It is specifically designed to target and neutralize the catalase enzyme, which plays a crucial role in various biological processes. This antibody exhibits strong catalase activity and has been shown to effectively inhibit the reactive properties of catalase. Additionally, it can bind to streptavidin and other peptide agents, making it versatile for use in different experimental setups. The HA antibody is water-soluble and can be easily incorporated into various assays and experiments. It is commonly used to detect and measure antiphospholipid antibodies in human serum samples, making it an essential tool for autoimmune disease research. With its high specificity and affinity, this monoclonal antibody ensures reliable results in any scientific investigation requiring the detection or neutralization of catalase or other related enzymes.

The RBM5 antibody is a powerful antiviral agent that belongs to the family of antibodies. It specifically targets proteins such as anti-mesothelin and alpha-fetoprotein, which are known to play a crucial role in various diseases. The RBM5 antibody has been shown to have neutralizing effects on these proteins, preventing them from causing harm to the body.

The PAK1 antibody is a highly specific antibody used in the field of Life Sciences. It is capable of recognizing and binding to the amino-terminal and carboxyl terminal regions of PAK1, a protein involved in various cellular processes. This antibody can be utilized for a wide range of applications, including immunoassays, Western blotting, immunohistochemistry, and more.

PCYT2 antibody was raised using the C terminal of PCYT2 corresponding to a region with amino acids KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII

Chlamydia antibody was raised in mouse using Chlamydia antigen as the immunogen.

Rabbit polyclonal TP53I3 antibody