Peptidi
Sottocategorie di "Peptidi"
Trovati 29635 prodotti di "Peptidi"
H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH
Peptide H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RGFFYTPKTRR-OH
Peptide H-RGFFYTPKTRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YKAAVDLSHFLKEKG-OH
Peptide H-YKAAVDLSHFLKEKG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ENILGSYFDVK-OH
Peptide H-ENILGSYFDVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPSLPTPPTR-OH
Peptide H-TPSLPTPPTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNEVAK-OH
Peptide H-LNEVAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GHPDLSVMYR-OH
Peptide H-GHPDLSVMYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IDPNAWVER-OH
Peptide H-IDPNAWVER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KFYSKISEY-OH
Peptide H-KFYSKISEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSGKLICTTAVPWNS-OH
Peptide H-CSGKLICTTAVPWNS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HGLDNYR-OH
Peptide H-HGLDNYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RQDILDLWV-OH
Peptide H-RQDILDLWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GAFGEATLYR-OH
Peptide H-GAFGEATLYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSATTFRLLWENGNLLR-OH
Peptide H-SSATTFRLLWENGNLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLQPQQPFPQQPQQPYPQQPQQPFPQ-OH
Peptide H-FLQPQQPFPQQPQQPYPQQPQQPFPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLQESNVLYQHNLR-OH
Peptide H-FLQESNVLYQHNLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TKCVIF-OH
Peptide H-TKCVIF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QFTSSTSYNR-OH
Peptide H-QFTSSTSYNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RAYATEPHAK-OH
Peptide H-RAYATEPHAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KKRPQRATSNVFC-OH
Peptide H-KKRPQRATSNVFC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CTASLPQEDMEPNATPTTPEA-OH
Peptide H-CTASLPQEDMEPNATPTTPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VYLILEYAPLGTVYR-OH
Peptide H-VYLILEYAPLGTVYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DRFFKTLRAEQATQE-OH
Peptide H-DRFFKTLRAEQATQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ETLDPSAPK-OH
Peptide H-ETLDPSAPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IRQYLAQWLE-OH
Peptide H-IRQYLAQWLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VFTPLEVDVAK-OH
Peptide H-VFTPLEVDVAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ICDFGLAR-OH
Peptide H-ICDFGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPEVLLGSAR-OH
Peptide H-SPEVLLGSAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LGQQQPFPPQQPYPQPQPF-OH
Peptide H-LGQQQPFPPQQPYPQPQPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELVEPLTPSGEAPNQALLR-OH
Peptide H-ELVEPLTPSGEAPNQALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MNILLQYVVKSFD-OH
Peptide H-MNILLQYVVKSFD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TEGLQEALLK-OH
Peptide H-TEGLQEALLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GEYLPLLQGK-OH
Peptide H-GEYLPLLQGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YGSLPQKSQRSQDENPV-OH
Peptide H-YGSLPQKSQRSQDENPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VQFQSGGANSPALYLLDGLR-OH
Peptide H-VQFQSGGANSPALYLLDGLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LADLQVPR-OH
Peptide H-LADLQVPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTIIPQDPILFSGSLR-OH
Peptide H-LTIIPQDPILFSGSLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NPVVHFFKNIVTPRT-OH
Peptide H-NPVVHFFKNIVTPRT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QYIKWPWYI-OH
Peptide H-QYIKWPWYI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DDFR-OH
Peptide H-DDFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TDPGVFIGVK-OH
Peptide H-TDPGVFIGVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNVETDTAEIR-OH
Peptide H-LNVETDTAEIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GIGAVLKVLTTGLPALISWIKRKRQQ-OH
Peptide H-GIGAVLKVLTTGLPALISWIKRKRQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGSTENLK-OH
Peptide H-IGSTENLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AETSELHTSLK-OH
Peptide H-AETSELHTSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Chloromethyl Polystyrene Resin cross-linked with 1% DVB (200-400mesh) (0.8-1.3mmol/g)
CAS:Colore e forma:SolidH-SLFNTIAVL-OH
Peptide H-SLFNTIAVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GWEPDDNPI-OH
Peptide H-GWEPDDNPI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLLRLTG-OH
Peptide H-NLLRLTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VDWENVSPEL-OH
Peptide H-VDWENVSPEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TFTLLDPK-OH
Peptide H-TFTLLDPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVKFRGSTGGKAPRGKAPATSGMVGPHR-OH
Peptide H-GVKFRGSTGGKAPRGKAPATSGMVGPHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KALARQLGVAA-OH
Peptide H-KALARQLGVAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VDFTLSSER-OH
Peptide H-VDFTLSSER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLGPLLVLQA-OH
Peptide H-FLGPLLVLQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPFDKSTIM-OH
Peptide H-LPFDKSTIM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLEWVAEIR-OH
Peptide H-GLEWVAEIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLHDSPLTPGQGGGYGRKKRRQRRR-OH
Peptide H-SLHDSPLTPGQGGGYGRKKRRQRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EDVPSER-OH
Peptide H-EDVPSER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SRVTWYDFLMEDTKSR-OH
Peptide H-SRVTWYDFLMEDTKSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLIIVLVMI-OH
Peptide H-FLIIVLVMI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RLSALESRV-OH
Peptide H-RLSALESRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PRCGNPDVA-OH
Peptide H-PRCGNPDVA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NSSKVSQNY-OH
Peptide H-NSSKVSQNY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLPFQQFGR-OH
Peptide H-FLPFQQFGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IWYINCFGCETHAML-OH
Peptide H-IWYINCFGCETHAML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTILDQSEAPVR-OH
Peptide H-LTILDQSEAPVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IVQL-OH
Peptide H-IVQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLTWASR-OH
Peptide H-YLTWASR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EQVTNVGGAVVTGVTAVAQK-OH
Peptide H-EQVTNVGGAVVTGVTAVAQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AGQAVDDFIEK-OH
Peptide H-AGQAVDDFIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-APEEILAEK-OH
Peptide H-APEEILAEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ERNAGSGIIISDT-OH
Peptide H-ERNAGSGIIISDT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NMQALSMPVT-OH
Peptide H-NMQALSMPVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LEQLESIINFEKLTEWTS-OH
Peptide H-LEQLESIINFEKLTEWTS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FFGQNTAAIAATEAQ-OH
Peptide H-FFGQNTAAIAATEAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QKWDATATELNNALQ-OH
Peptide H-QKWDATATELNNALQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SGATGVAIK-OH
Peptide H-SGATGVAIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FASIR-OH
Peptide H-FASIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CPTNDKAKAGNKP-OH
Peptide H-CPTNDKAKAGNKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KKKK-OH
Peptide H-KKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLLKFLAKV-OH
Peptide H-SLLKFLAKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YQAIFDNTTSLTDK-OH
Peptide H-YQAIFDNTTSLTDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SIRPPYPSY-OH
Peptide H-SIRPPYPSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YTTGEIIGDIRQAHC-OH
Peptide H-YTTGEIIGDIRQAHC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DRVYIHPFHL-OH
Negative control peptide for OVA (257-264). This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Colore e forma:PowderL-Serine
CAS:Formula:C3H7NO3Purezza:>99.0%(T)Colore e forma:White to Almost white powder to crystalPeso molecolare:105.09H-LKEFGNTLEDK-OH
Peptide H-LKEFGNTLEDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ADFYNPK-OH
Peptide H-ADFYNPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSRAHSSHLKSKKGQSTSRHKK-OH
Peptide H-GSRAHSSHLKSKKGQSTSRHKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EYLFEVDNL-OH
Peptide H-EYLFEVDNL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PKYVKQNTLKLA-OH
Peptide H-PKYVKQNTLKLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GIAGFKGEQGPK-OH
Peptide H-GIAGFKGEQGPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MPGMFFSANPK-OH
Peptide H-MPGMFFSANPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CTFEYVSQPFLMDLE-OH
Peptide H-CTFEYVSQPFLMDLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TPVITGAPYEYR-OH
Peptide H-TPVITGAPYEYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QITVNDLPVGR-OH
Peptide H-QITVNDLPVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FEDENFILK-OH
Peptide H-FEDENFILK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IQIIPK-OH
Peptide H-IQIIPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLHAHGLSYK-OH
Peptide H-SLHAHGLSYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
