
Peptidi
Sottocategorie di "Peptidi"
Trovati 29874 prodotti di "Peptidi"
H-MHVAQPAVVLASSR-OH
Peptide H-MHVAQPAVVLASSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WMHHNMDLI-OH
Peptide H-WMHHNMDLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SQLTKPISSLTKPYH-OH
Peptide H-SQLTKPISSLTKPYH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YKVVKIEPL-OH
Peptide H-YKVVKIEPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CTASNKNRGIIKTFS-OH
Peptide H-CTASNKNRGIIKTFS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YIPEITLPV-OH
Peptide H-YIPEITLPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SQIMYNYPA-OH
Peptide H-SQIMYNYPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CEKAHDGGR-OH
Peptide H-CEKAHDGGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVQREKRAVGIGAMF-OH
Peptide H-VVQREKRAVGIGAMF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-rytvela-OH
Peptide H-rytvela-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLNEAVFNFV-OH
Peptide H-YLNEAVFNFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DFTYR-OH
Peptide H-DFTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VTPEIPAGLPSPR-OH
Peptide H-VTPEIPAGLPSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELVSEFSR-OH
Peptide H-ELVSEFSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HIATNAVLFFGR-OH
Peptide H-HIATNAVLFFGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GYAGTLQSL-OH
Peptide H-GYAGTLQSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SHLVEALYLVAGERG-OH
Peptide H-SHLVEALYLVAGERG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FGPGVAFR-OH
Peptide H-FGPGVAFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ESLTEDEATQFLK-OH
Peptide H-ESLTEDEATQFLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ESTD-OH
Peptide H-ESTD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ENREILKEPVHGVYY-OH
Peptide H-ENREILKEPVHGVYY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLAVTDSPAR-OH
Peptide H-VLAVTDSPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PGCAFLTV-OH
Peptide H-PGCAFLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTPQAFSHFTFER-OH
Peptide H-LTPQAFSHFTFER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FYGAEIVSALDYLHSEK-OH
Peptide H-FYGAEIVSALDYLHSEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSLEIEQLELQR-OH
Peptide H-LSLEIEQLELQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISLPESLK-OH
Peptide H-ISLPESLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IYSQKRQDILDLWVY-OH
Peptide H-IYSQKRQDILDLWVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SPVVSGDTSPR-OH
Peptide H-SPVVSGDTSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELINNELSHFLEEIK-OH
Peptide H-ELINNELSHFLEEIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVEEVSLRK-OH
Peptide H-AVEEVSLRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLADEFIIPGLK-OH
Peptide H-VLADEFIIPGLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IVKWDRDM-OH
Peptide H-IVKWDRDM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DTLYITR-OH
Peptide H-DTLYITR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IGQGTFGEVFK-OH
Peptide H-IGQGTFGEVFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLEEMFLTV-OH
Peptide H-LLEEMFLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLTPELYAELR-OH
Peptide H-VLTPELYAELR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LMGYIPLVGA-OH
Peptide H-LMGYIPLVGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VDPVNFK-OH
Peptide H-VDPVNFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LEVFYNGAWGTVGK-OH
Peptide H-LEVFYNGAWGTVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QMESQPLPGER-OH
Peptide H-QMESQPLPGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLLPTGAEA-OH
Peptide H-FLLPTGAEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MLTELEK-OH
Peptide H-MLTELEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EGEWTEGKLSLRGSC-OH
Peptide H-EGEWTEGKLSLRGSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLDLDSIIAEVK-OH
Peptide H-SLDLDSIIAEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLSLLTTLSNR-OH
Peptide H-HLSLLTTLSNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RYPLTFGW-OH
Peptide H-RYPLTFGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WWW-OH
Peptide H-WWW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTGGANIDPTFFLSR-OH
Peptide H-GTGGANIDPTFFLSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPFEKSTVM-OH
Peptide H-LPFEKSTVM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVVRYRRNV-OH
Peptide H-LVVRYRRNV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NAPYLPSCL-OH
Peptide H-NAPYLPSCL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLFNTVAVL-OH
Peptide H-SLFNTVAVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILDTAGREEY-OH
Peptide H-ILDTAGREEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ADLSGITGAR-OH
Peptide H-ADLSGITGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GEIYKRWII-OH
Peptide H-GEIYKRWII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YFIIQDR-OH
Peptide H-YFIIQDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TEFENIIMQLVK-OH
Peptide H-TEFENIIMQLVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLVVVGAVG-OH
Peptide H-KLVVVGAVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KIVEMSTSK-OH
Peptide H-KIVEMSTSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ANALLANGVELR-OH
Peptide H-ANALLANGVELR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLAWEWWRTVI-OH
Peptide H-GLAWEWWRTVI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILLSELSRRRIR-OH
Peptide H-ILLSELSRRRIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EEFPTDLKPEEVAQE-OH
Peptide H-EEFPTDLKPEEVAQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLEQELETITIPDVYGAK-OH
Peptide H-FLEQELETITIPDVYGAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MLLSKINSL-OH
Peptide H-MLLSKINSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PVQL-OH
Peptide H-PVQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GEISPLPSL-OH
Peptide H-GEISPLPSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KVFGRCELAAAMKRHGLD-OH
Peptide H-KVFGRCELAAAMKRHGLD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLHAHGLSYK-OH
Peptide H-SLHAHGLSYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YQAIFDNTTSLTDK-OH
Peptide H-YQAIFDNTTSLTDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLLKFLAKV-OH
Peptide H-SLLKFLAKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FASIR-OH
Peptide H-FASIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGATGVAIK-OH
Peptide H-SGATGVAIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QKWDATATELNNALQ-OH
Peptide H-QKWDATATELNNALQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PRPRPR-OH
Peptide H-PRPRPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NMQALSMPVT-OH
Peptide H-NMQALSMPVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GFNKLRSTL-OH
Peptide H-GFNKLRSTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AGQAVDDFIEK-OH
Peptide H-AGQAVDDFIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLTWASR-OH
Peptide H-YLTWASR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IVQL-OH
Peptide H-IVQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PRCGNPDVA-OH
Peptide H-PRCGNPDVA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLEWVAEIR-OH
Peptide H-GLEWVAEIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GWYTSVITIELSNIKE-OH
Peptide H-GWYTSVITIELSNIKE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VDWENVSPEL-OH
Peptide H-VDWENVSPEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Chloromethyl Polystyrene Resin cross-linked with 1% DVB (200-400mesh) (0.8-1.3mmol/g)
CAS:Colore e forma:SolidH-AETSELHTSLK-OH
Peptide H-AETSELHTSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNVETDTAEIR-OH
Peptide H-LNVETDTAEIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DDFR-OH
Peptide H-DDFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KSLYNTVCV-OH
Peptide H-KSLYNTVCV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YGSLPQKSQRSQDENPV-OH
Peptide H-YGSLPQKSQRSQDENPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MNILLQYVVKSFD-OH
Peptide H-MNILLQYVVKSFD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ICDFGLAR-OH
Peptide H-ICDFGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALLTSRLRFI-OH
Peptide H-ALLTSRLRFI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QFTSSTSYNR-OH
Peptide H-QFTSSTSYNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KKKKKKKK-OH
Peptide H-KKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNEVAK-OH
Peptide H-LNEVAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TPSLPTPPTR-OH
Peptide H-TPSLPTPPTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH
Peptide H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HLA leader peptide LLL (8mer)
Fragment of the signal peptide from endogenous HLA Class I molecules which is also found in viral glycoproteins, for example human Cytomegalovirus (hCMV) protein UL40. When presented on a cell surface via HLA-E molecules, the HLA- VMAPRTLLL complex binds NKG2A receptors on Natural Killer (NK) cells and some CD8⁺ cytotoxic T cells to reduce their cytotoxic activity. Blocking this interaction is an attractive opportunity for immune checkpoint (IC) approach therapies. This is relevant in both cancer therapies, and viral infections, where endogenous HLA Class I peptide presentation is exploited to escape immune attack. In one study, VMAPRTLLL UL4015-23 was found in 10% congenital cytomegalovirus (cCMV) strains.Peptide H-VMAPRTLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

