Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30315 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-SLGPALLLLQK-OH
<p>Peptide H-SLGPALLLLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-HAVDIGGGKC-OH acetate salt 98%
Custom research peptide; min purity 98%. For different specs please use the Peptide Quote ToolH-GISVHISNAEPK-OH
Peptide H-GISVHISNAEPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FIHHIIGGLFSAGKAIHRLIRRRRR-OH
H-FIHHIIGGLFSAGKAIHRLIRRRRR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-QLLQHYREV-OH
Peptide H-QLLQHYREV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CLAVYQAGAR-OH
<p>Peptide H-CLAVYQAGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KIGAKIKIGAKIKIGAKI-OH
Peptide H-KIGAKIKIGAKIKIGAKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HHQKLVFF-NH2
Peptide H-HHQKLVFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YRSGIIAVV-OH
<p>Peptide H-YRSGIIAVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YICEEASVTV-OH
<p>Peptide H-YICEEASVTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SEVAHR-OH
Peptide H-SEVAHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELLHAPATV-OH
Peptide H-ELLHAPATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAAAAAAAAAA-OH
Peptide H-AAAAAAAAAAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLPEVEVPQHL-OH
H-RLPEVEVPQHL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C59H97N17O17Peso molecolare:1,316.52 g/molH-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C190H288N54O57Peso molecolare:4,240.7 g/molH-HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG-OH
CAS:<p>H-HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C149H221N37O49Peso molecolare:3,314.61 g/molH-QHFVQENYLEY-OH
<p>Peptide H-QHFVQENYLEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VFSVSLSNPSTGK-OH
Peptide H-VFSVSLSNPSTGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAEFRHDS-NH2
Peptide H-DAEFRHDS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAGAGAGAGAGAGAGA-OH
Peptide H-GAGAGAGAGAGAGAGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLDKGTYTL-OH
H-FLDKGTYTL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-ALIVFWKYR-OH
Peptide H-ALIVFWKYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WMHHNMLDI-OH
<p>Peptide H-WMHHNMLDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FMVFLQTHI-OH
Peptide H-FMVFLQTHI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALWMTLLKKVLKAAAKAALNAVLVGANA-OH
H-ALWMTLLKKVLKAAAKAALNAVLVGANA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C132H229N35O32SPeso molecolare:2,850.55 g/molH-MFGGAKKR-OH
Peptide H-MFGGAKKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPRPV-OH
Peptide H-GPRPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HNLFEPEDTGQR-OH
Peptide H-HNLFEPEDTGQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GIVEQCCTSICSLYQ-OH
<p>Peptide H-GIVEQCCTSICSLYQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PETERT-OH
Peptide H-PETERT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLQQNWWTL-OH
Peptide H-YLQQNWWTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SAYGEPRKL-OH
Peptide H-SAYGEPRKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GRVRVNSAYGDKVSL-OH
<p>Peptide H-GRVRVNSAYGDKVSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPEPLPQGQLTAY-OH
Peptide H-LPEPLPQGQLTAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AKKVRRAIEQLAAMD-OH
Peptide H-AKKVRRAIEQLAAMD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGIDWASGR-OH
Peptide H-YGIDWASGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RTSCREACL-OH
<p>Peptide H-RTSCREACL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKSRGDYMTMQIG-OH
Peptide H-KKSRGDYMTMQIG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CEEEEYMPME-OH
<p>Peptide H-CEEEEYMPME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MGSLEMVPM-OH
Peptide H-MGSLEMVPM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DSSESSDSGSSSESDGD-OH
<p>Peptide H-DSSESSDSGSSSESDGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NAPPEPVPPPR-OH
H-NAPPEPVPPPR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-GGGGSGGGS-OH
<p>Peptide H-GGGGSGGGS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LIEDNEYTAR-OH
<p>Peptide H-LIEDNEYTAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QQNWWTLLV-OH
<p>Peptide H-QQNWWTLLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FFVPPFQQSPR-OH
Peptide H-FFVPPFQQSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRHRILDIYL-OH
Peptide H-RRHRILDIYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLLDLHSYL-OH
Peptide H-YLLDLHSYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSSPSMPEL-OH
Peptide H-TSSPSMPEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALKATFSGFKKEQRRLGCC-OH acetate salt
Custom research peptide; min purity 98%. For different specs please use the Peptide Quote ToolH-AASLDGFYNGR-OH
Peptide H-AASLDGFYNGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIDTVLPNK-OH
Peptide H-EIDTVLPNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLVVVGAGGVGK-OH
Peptide H-KLVVVGAGGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SELEEQLTPVAEETR-OH
<p>Peptide H-SELEEQLTPVAEETR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RDDP-OH
<p>Peptide H-RDDP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPRWYFYYL-OH
Peptide H-SPRWYFYYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLRGRAYGL-OH
Peptide H-FLRGRAYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILDDNLYKV-OH
<p>Peptide H-ILDDNLYKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFNGGP-NH2
Peptide H-SFNGGP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C25H36N8O8Peso molecolare:576.6 g/molH-SLYNTIAVL-OH
<p>Peptide H-SLYNTIAVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VPNGRGD-OH
Peptide H-VPNGRGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VEGAGEEQAAK-OH
Peptide H-VEGAGEEQAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELINNELSHFLEEIK-OH
<p>Peptide H-ELINNELSHFLEEIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DAHKSEVAHRFKDLGEENFKALVL-OH
Peptide H-DAHKSEVAHRFKDLGEENFKALVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FAVNPGLLETSEGCR-OH
Peptide H-FAVNPGLLETSEGCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLQEAAEER-OH
Peptide H-GLQEAAEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CTEST-OH
Peptide H-CTEST-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HRGHQPPPEMA-OH
<p>Peptide H-HRGHQPPPEMA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FNWYVDDVEVHNAK-OH
Peptide H-FNWYVDDVEVHNAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYDLDPGAGSLEI-OH
Peptide H-SYDLDPGAGSLEI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLWAAQRYGRELRRMSDEFVD-OH
<p>H-NLWAAQRYGRELRRMSDEFVD-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-GIPKNPWLWSEQGCC-OH acetate salt
Custom research peptide; min purity 98%. For different specs please use the Peptide Quote ToolH-CLQAGASQ-OH
Peptide H-CLQAGASQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLLRREVYDFAFRDL-OH
Peptide H-QLLRREVYDFAFRDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNNISIIGPLDMK-OH
Peptide H-LNNISIIGPLDMK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLVALGLNAV-OH
Peptide H-KLVALGLNAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTEFWK-OH
<p>Peptide H-TTEFWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLNLGPITR-OH
<p>Peptide H-VLNLGPITR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAPEEHPVLLTEAPLNPK-OH
Peptide H-VAPEEHPVLLTEAPLNPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYLMFWIGVTSVLLLFIVYAYMYILWYGRKKRRQRRR-OH
H-TYLMFWIGVTSVLLLFIVYAYMYILWYGRKKRRQRRR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C229H352N60O47S2Peso molecolare:4,761.81 g/molH-GILGLVFTL-OH
Peptide H-GILGLVFTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLAAQGMAY-OH
Peptide H-HLAAQGMAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGGGGSGGGGSGGGG-OH
Peptide H-SGGGGSGGGGSGGGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EKDPIKENY-OH
Peptide H-EKDPIKENY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASNENMETM -OH
Peptide H-ASNENMETM -OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPSVFPLAPSSR-OH
Peptide H-GPSVFPLAPSSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQGQWTYQI-OH
Peptide H-GQGQWTYQI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MDYKDDDDK-OH
Peptide H-MDYKDDDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGEATDGARPQALPEPMQESK-OH
<p>Peptide H-SGEATDGARPQALPEPMQESK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGNYTCEVTELTREGETIIELK-OH
<p>Peptide H-CGNYTCEVTELTREGETIIELK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VSLSYR-OH
<p>Peptide H-VSLSYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGIPYIISYLHPGNTILHVD-OH
Peptide H-SGIPYIISYLHPGNTILHVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YFDLGLPNR-OH
<p>Peptide H-YFDLGLPNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AQGISAEPQTYR-OH
<p>Peptide H-AQGISAEPQTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FVQENYLEY-OH
Peptide H-FVQENYLEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELMTLATWV-OH
<p>Peptide H-ELMTLATWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPRKPIKCW-OH
Peptide H-GPRKPIKCW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KKVVALYDYMPMN-OH
<p>Peptide H-KKVVALYDYMPMN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLHVMHKVAPPRGGGC-OH
<p>Peptide H-GLHVMHKVAPPRGGGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KPIVQYDNF-OH
<p>Peptide H-KPIVQYDNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
