Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30372 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-GLVQPGGSL-OH
<p>Peptide H-GLVQPGGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASGAFGTVYK-OH
<p>Peptide H-ASGAFGTVYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSIEGNR-OH
<p>Peptide H-FSIEGNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLCLRPVGA-OH
<p>Peptide H-VLCLRPVGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSNLQEQIAW-OH
<p>Peptide H-TSNLQEQIAW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IALGGLLFPASNLR-OH
<p>Peptide H-IALGGLLFPASNLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFKNFNTATPSLE-OH
<p>Peptide H-TFKNFNTATPSLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IYLPHSLPQQ-OH
<p>Peptide H-IYLPHSLPQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QDGNEEMGGITQTPYKVSISGTTVILT-OH
<p>Peptide H-QDGNEEMGGITQTPYKVSISGTTVILT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EDSQCVIGLYQPPLQVY-OH
<p>Peptide H-EDSQCVIGLYQPPLQVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGTLLPLQK-OH
Peptide H-LGTLLPLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYLDSGIHF-OH
<p>Peptide H-SYLDSGIHF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILDFGLAR-OH
Peptide H-ILDFGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KSVTREDTGTYTC-OH
<p>Peptide H-KSVTREDTGTYTC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FAQ-OH
<p>Peptide H-FAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSAAPPPPPR-OH
Peptide H-SSAAPPPPPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VQAAVGTSAAPVPSDNH-OH
<p>Peptide H-VQAAVGTSAAPVPSDNH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GITWK-OH
<p>Peptide H-GITWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVGAGDVGK-OH
Peptide H-VVGAGDVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EVHTNQDPLD-OH
<p>Peptide H-EVHTNQDPLD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRGF-OH
<p>Peptide H-RRGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ISKANVDVL-OH
<p>Peptide H-ISKANVDVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HVPGGGSVQIVYKPVDLSK-OH
<p>Peptide H-HVPGGGSVQIVYKPVDLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QQTVGGVNYFFDVEVGR-OH
Peptide H-QQTVGGVNYFFDVEVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IFLAGDKDNVIDQIEK-OH
<p>Peptide H-IFLAGDKDNVIDQIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CTPTDVRDVDI-OH
<p>Peptide H-CTPTDVRDVDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPIESHQVEK-OH
<p>Peptide H-TPIESHQVEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGPGRAFYA-OH
<p>Peptide H-IGPGRAFYA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AIWNVINWENVTER-OH
<p>Peptide H-AIWNVINWENVTER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLGDVDQLVK-OH
<p>Peptide H-GLGDVDQLVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKRYDREFLLGFQF-OH
<p>Peptide H-KKRYDREFLLGFQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIDQTPYK-OH
<p>Peptide H-EIDQTPYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPVDLAEELGHR-OH
<p>Peptide H-LPVDLAEELGHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TITLEVEPSDTIENVK-OH
<p>Peptide H-TITLEVEPSDTIENVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YDVDTLDMVFLDHWK-OH
<p>Peptide H-YDVDTLDMVFLDHWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PLTFGWCYKLV-OH
<p>Peptide H-PLTFGWCYKLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLGATCMFV-OH
<p>Peptide H-LLGATCMFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YMIGVLLGV-OH
<p>Peptide H-YMIGVLLGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLWDQGNFPLIIK-OH
<p>Peptide H-SLWDQGNFPLIIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YTFAFGGNYDR-OH
<p>Peptide H-YTFAFGGNYDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TKAARKSAPAT-OH
<p>Peptide H-TKAARKSAPAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NFNTVPYIVGINK-OH
<p>Peptide H-NFNTVPYIVGINK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLDEFMEGV-OH
Peptide H-FLDEFMEGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FDTLVGER-OH
Peptide H-FDTLVGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLFGAIAGFIEGGW-OH
<p>Peptide H-GLFGAIAGFIEGGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKQFEELTLGEFLKL-OH
<p>Peptide H-KKQFEELTLGEFLKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KITDFGRAK-OH
<p>Peptide H-KITDFGRAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTQLGTFEDHFLSLQR-OH
<p>Peptide H-LTQLGTFEDHFLSLQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CERRKSPLQDPF-OH
<p>Peptide H-CERRKSPLQDPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-THLAPYSDELR-OH
<p>Peptide H-THLAPYSDELR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAVQNEVTL-OH
<p>Peptide H-GAVQNEVTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KGK-OH
<p>Peptide H-KGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YSQAVPAVTEGPIPEVLK-OH
<p>Peptide H-YSQAVPAVTEGPIPEVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LEDGPKFL-OH
<p>Peptide H-LEDGPKFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLPQGFSALEPLVDLPIGINITR-OH
<p>Peptide H-DLPQGFSALEPLVDLPIGINITR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AQDGGPVGTELFR-OH
Peptide H-AQDGGPVGTELFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVGKLNWASQIY-OH
Peptide H-LVGKLNWASQIY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSEEMRHRFRQLDTKLNDLKG-OH
<p>Peptide H-CSEEMRHRFRQLDTKLNDLKG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VEALYLVCGEEG-OH
<p>Peptide H-VEALYLVCGEEG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRQPPRSISSHP-OH
Peptide H-RRQPPRSISSHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SWMESEFRVY-OH
<p>Peptide H-SWMESEFRVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DYKDHDGDYKDHDIDYKDDDDK-OH
<p>H-DYKDHDGDYKDHDIDYKDDDDK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-DYKDDDDKDYKDDDDKDYKDDDDK-OH
<p>H-DYKDDDDKDYKDDDDKDYKDDDDK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-OH
Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH
<p>H-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C211H318N62O59S3Peso molecolare:4,763.42 g/molH-VSEHFSLLF-OH
<p>Peptide H-VSEHFSLLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RIANFKIEPPGLFRGRGNHP-OH
<p>Peptide H-RIANFKIEPPGLFRGRGNHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LYATVIHDI-OH
<p>H-LYATVIHDI-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-EITPEKNPQ-OH
Peptide H-EITPEKNPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KKKKKKKKKKKK-OH
<p>Peptide H-KKKKKKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSDQIHFFFAK-OH
<p>Peptide H-TSDQIHFFFAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSTLGLDIETATR-OH
<p>H-GSTLGLDIETATR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-INWLKLGKMVIDAL-OH
<p>H-INWLKLGKMVIDAL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C76H129N19O17SPeso molecolare:1,613.04 g/molH-AFLLTPR-OH
<p>Peptide H-AFLLTPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSKKDKPLCKKHAHSVNF-OH
<p>Peptide H-FSKKDKPLCKKHAHSVNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KTCPVQLWV-OH
<p>Peptide H-KTCPVQLWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DCAWHLGELVWCT-OH
<p>Peptide H-DCAWHLGELVWCT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KHFGKDSNFPF-NH2
H-KHFGKDSNFPF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-TESTTEST-OH
<p>Peptide H-TESTTEST-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPKPIPGNW-OH
<p>Peptide H-DPKPIPGNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YDGREHTV-OH
<p>Peptide H-YDGREHTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAELVHFLL-OH
<p>H-VAELVHFLL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-TNEFSLVNVNLQGCC-OH acetate salt
<p>Custom research peptide; min purity 98%. For different specs please use the Peptide Quote Tool</p>H-FIRHNPTGAVLFMGQINKP-OH
<p>H-FIRHNPTGAVLFMGQINKP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C98H154N28O24S1Peso molecolare:2,140.54 g/molH-AFLGERVTL-OH
Peptide H-AFLGERVTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVMEKNIVL-OH
Peptide H-AVMEKNIVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLFGEPKRL-OH
<p>Peptide H-FLFGEPKRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSFFLYSKLTVD-OH
<p>Peptide H-GSFFLYSKLTVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
<p>H-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C140H214N36O43Peso molecolare:3,089.45 g/molH-GPRPK-OH
<p>Peptide H-GPRPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YTIWMPENPRPGTPCDIFTNSRGKRASNG-NH2
CAS:<p>Peptide H-YTIWMPENPRPGTPCDIFTNSRGKRASNG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH
<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-GVVPHDFRI-OH
<p>H-GVVPHDFRI-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C48H74N14O12Peso molecolare:1,039.2 g/molH-GVLTLNFQ-OH
Peptide H-GVLTLNFQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MMMMMMMMMMMM-OH
<p>Peptide H-MMMMMMMMMMMM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KWKLFKKIGAVLKVL-NH2
Peptide H-KWKLFKKIGAVLKVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C89H152N22O15Peso molecolare:1,770.32 g/molH-TIDYFQPNNK-OH
Peptide H-TIDYFQPNNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PFAV-OH
<p>Peptide H-PFAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPVSDR-OH
<p>Peptide H-TPVSDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLDEVTYLEASK-OH
<p>Peptide H-LLDEVTYLEASK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
