Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30433 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-ESLSSYWESAK-OH
<p>Peptide H-ESLSSYWESAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IAFTSEHSHFSLK-OH
<p>Peptide H-IAFTSEHSHFSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STLQ-OH
<p>Peptide H-STLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RGPESRLL-OH
<p>Peptide H-RGPESRLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SEEPPISLDLTFHLLR-OH
<p>Peptide H-SEEPPISLDLTFHLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KTKRKRKKQRVKIAYEEIFVKNM-OH
<p>Peptide H-KTKRKRKKQRVKIAYEEIFVKNM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSIINFEKL-OH
<p>Peptide H-CSIINFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRKRR-OH
<p>Peptide H-RRKRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SESSTILVV-OH
<p>Peptide H-SESSTILVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PFDVS-OH
<p>Peptide H-PFDVS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ETIEQEK-OH
<p>Peptide H-ETIEQEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLSKQYMDL-OH
<p>Peptide H-FLSKQYMDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LIFAGKQLEDGR-OH
<p>Peptide H-LIFAGKQLEDGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSESGELHGLTTEEEFVEGIYKVEIDTK-OH
<p>Peptide H-TSESGELHGLTTEEEFVEGIYKVEIDTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RQDNEILIFWSK-OH
<p>Peptide H-RQDNEILIFWSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLIQNSLTIERMVLS-OH
<p>Peptide H-RLIQNSLTIERMVLS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YTAFTIPSI-OH
<p>Peptide H-YTAFTIPSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELRDKKQKVHALFYK-OH
<p>Peptide H-ELRDKKQKVHALFYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EGLELPEDEEEK-OH
<p>Peptide H-EGLELPEDEEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EYRALQLHL-OH
<p>Peptide H-EYRALQLHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGNIILEK-OH
<p>Peptide H-IGNIILEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KAVSNFATM-OH
<p>Peptide H-KAVSNFATM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVT-OH
<p>Peptide H-TVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LYEKVKSQL-OH
<p>Peptide H-LYEKVKSQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VPGVG-OH
<p>Peptide H-VPGVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLINVGSR-OH
<p>Peptide H-LLINVGSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SNYNKSVNV-OH
<p>Peptide H-SNYNKSVNV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGVEVLEVK-OH
<p>Peptide H-GGVEVLEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGHGVSIEW-OH
<p>Peptide H-LGHGVSIEW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVPAFFWTDK-OH
<p>Peptide H-SVPAFFWTDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKFA-OH
<p>Peptide H-KKFA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ARSHPAM-OH
<p>Peptide H-ARSHPAM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FF-OH
<p>Peptide H-FF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PKYVKQNTLKLAT-OH
<p>Peptide H-PKYVKQNTLKLAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLSWVALFL-OH
<p>Peptide H-LLSWVALFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGMQIFVK-OH
<p>Peptide H-GGMQIFVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LKKILAYFLPEDAILK-OH
<p>Peptide H-LKKILAYFLPEDAILK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FG-OH
<p>Peptide H-FG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EKYNLTSVL-OH
<p>Peptide H-EKYNLTSVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAFDLSFFL-OH
<p>Peptide H-AAFDLSFFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG-OH
<p>Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NPPIPVGEIYKRWII-OH
<p>Peptide H-NPPIPVGEIYKRWII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HHHHHHC-OH
<p>Peptide H-HHHHHHC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTFPQLAK-OH
<p>Peptide H-DTFPQLAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SNLKPFER-OH
<p>Peptide H-SNLKPFER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NPANPVQR-OH
<p>Peptide H-NPANPVQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KIQEILTQVK-OH
<p>Peptide H-KIQEILTQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TRPNNNTRKSIHIGP-OH
<p>Peptide H-TRPNNNTRKSIHIGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPFERATVM-OH
<p>Peptide H-LPFERATVM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LFLEPTR-OH
<p>Peptide H-LFLEPTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGPDNGAVAV-OH
<p>Peptide H-SGPDNGAVAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GEPGPAGAVGPAGAVGPR-OH
<p>Peptide H-GEPGPAGAVGPAGAVGPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVINSGNGAVEDR-OH
<p>Peptide H-LVINSGNGAVEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLFGYPVYV-OH
<p>Peptide H-LLFGYPVYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DGD-OH
<p>Peptide H-DGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RKLADA-OH
<p>Peptide H-RKLADA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTPTAENPEYLGLDVPV-OH
<p>Peptide H-GTPTAENPEYLGLDVPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VITAFNDGLNHLDSLK-OH
<p>Peptide H-VITAFNDGLNHLDSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SANSNPAMAPRERKAGCKNFFWKTFTSC-OH
<p>Peptide H-SANSNPAMAPRERKAGCKNFFWKTFTSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IIDNKPSIDSYSK-OH
<p>Peptide H-IIDNKPSIDSYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VHLTPEEKSAVTAL-OH
<p>Peptide H-VHLTPEEKSAVTAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RDG-OH
<p>Peptide H-RDG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MOTS-c (Mouse)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C69H99N13O17S2Peso molecolare:1,446.74 g/molH-GLNDIFEAQKIEWHE-OH
<p>Peptide H-GLNDIFEAQKIEWHE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTTFAEGVVAFLILPQAK-OH
Peptide H-GTTFAEGVVAFLILPQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVAGVANALAHR-OH
<p>Peptide H-VVAGVANALAHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AIIGLMVGGVV-OH
<p>Peptide H-AIIGLMVGGVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FEIFPK-OH
<p>Peptide H-FEIFPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GDLGIEIPAEK-OH
<p>Peptide H-GDLGIEIPAEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QRMF-OH
<p>Peptide H-QRMF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLVAMGINAV-OH
<p>Peptide H-KLVAMGINAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLGR-OH
<p>Peptide H-RLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VRSRRCLRL-OH
<p>Peptide H-VRSRRCLRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLVHPQWVL-OH
<p>Peptide H-VLVHPQWVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGGTWYKIAFQRNRK-OH
<p>Peptide H-CGGTWYKIAFQRNRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HiBiT tag
<p>Peptide H-VSGWRLFKKIS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AALLNKLYA-OH
<p>Peptide H-AALLNKLYA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FAFTIPAI-OH
<p>Peptide H-FAFTIPAI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WASRELERF-OH
<p>Peptide H-WASRELERF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYIRPFETKVK-OH
<p>Peptide H-TYIRPFETKVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVSSENFDDYMK-OH
<p>Peptide H-LVSSENFDDYMK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSLYQLENY-OH
<p>Peptide H-CSLYQLENY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALFYKLDVVPIDNDN-OH
<p>Peptide H-ALFYKLDVVPIDNDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-A^^A^^KIQA^^SFRGHMA^^RKK-OH
<p>Peptide LCBiot-A^^A^^KIQA^^SFRGHMA^^RKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Peso molecolare:2,151.63 g/molH-SLQPLALEGSLQKRG-OH
<p>Peptide H-SLQPLALEGSLQKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASQFVGSSIHWYQQR-OH
<p>Peptide H-ASQFVGSSIHWYQQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLQPLTFLL-OH
<p>Peptide H-KLQPLTFLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EILVGDVGQTVDDPYATFVK-OH
<p>Peptide H-EILVGDVGQTVDDPYATFVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAYTGLPNKKPNVPTIRTAKVQ-OH
<p>Peptide H-GAYTGLPNKKPNVPTIRTAKVQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CKKKKKC-OH
<p>Peptide H-CKKKKKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLTHAQSTLDAK-OH
<p>Peptide H-HLTHAQSTLDAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HQAAMQMLKETINEE-OH
<p>Peptide H-HQAAMQMLKETINEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLQFKTWWI-OH
<p>Peptide H-FLQFKTWWI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DFTAAFPR-OH
<p>Peptide H-DFTAAFPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FGVAPDHPEVK-OH
<p>Peptide H-FGVAPDHPEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRVYIHPF-OH
<p>Peptide H-DRVYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSANYR-OH
<p>Peptide H-SSANYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SNPTYSVM-OH
Peptide H-SNPTYSVM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLIYDASNR-OH
<p>Peptide H-LLIYDASNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPPLDITPY-OH
<p>Peptide H-LPPLDITPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
