Peptidi
Sottocategorie di "Peptidi"
Trovati 29639 prodotti di "Peptidi"
Ref: 3D-VAC-00213
Prodotto fuori produzioneLeucopyrokinin (LPK)
Catalogue peptide; min. 95% purity
Formula:C42H66N12O12Peso molecolare:931.06 g/molRef: 3D-VAC-00201
Prodotto fuori produzioneSynaptobrevin-2 (73-79) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Formula:C32H48N8O14Peso molecolare:768.78 g/molRef: 3D-VAC-00255
Prodotto fuori produzioneTNF-α(10-36) (human)
Catalogue peptide; min. 95% purity
Formula:C131H211N43O38Peso molecolare:2,996.41 g/molRef: 3D-VAC-00330
Prodotto fuori produzioneMARCKS Protein (151-175)
Catalogue peptide; min. 95% purity
Formula:C147H243N41O31Peso molecolare:3,080.83 g/molRef: 3D-VAC-00526
Prodotto fuori produzioneRef: 3D-VAC-00439
Prodotto fuori produzione[Arg0] Met-Enkephalin
Catalogue peptide; min. 95% purity
Formula:C33H47N9O8SPeso molecolare:729.86 g/molRef: 3D-VAC-00699
Prodotto fuori produzioneRef: 3D-VAC-00392
Prodotto fuori produzioneBoc-Lys(Tfa)-AMC
CAS:Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Formula:C23H28F3N3O6Purezza:Min. 95%Peso molecolare:499.48 g/molα-Gliadin (57-73)
Catalogue peptide; min. 95% purity
Formula:C93H136N22O27Peso molecolare:1,994.25 g/molRef: 3D-VAC-00647
Prodotto fuori produzionePeptide YY (3-36) (canine, mouse, porcine, rat)
Catalogue peptide; min. 95% purity
Formula:C190H288N54O57Peso molecolare:4,240.64 g/molRef: 3D-VAC-00229
Prodotto fuori produzioneRef: 3D-VAC-00183
Prodotto fuori produzione[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
Catalogue peptide; min. 95% purity
Formula:C67H110N20O17Peso molecolare:1,467.75 g/molRef: 3D-VAC-00495
Prodotto fuori produzionebeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Formula:C147H227N39O43SPeso molecolare:3,260.75 g/molRef: 3D-VAC-00721
Prodotto fuori produzioneBiotin-Obestatin (human)
Catalogue peptide; min. 95% purity
Formula:C126H190N34O35Peso molecolare:2,773.19 g/molRef: 3D-VAC-00091
Prodotto fuori produzioneNTB (Naltriben)
Catalogue peptide; min. 95% purity
Formula:C50H65N11O11S2Peso molecolare:1,060.29 g/molRef: 3D-VAC-00140
Prodotto fuori produzionebeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Formula:C28H45N7O9Peso molecolare:623.71 g/molRef: 3D-VAC-00890
Prodotto fuori produzioneZ-Gly-Gly-Trp-OH TFA
CAS:Please enquire for more information about Z-Gly-Gly-Trp-OH TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C23H24N4O6•C2HF3O2Purezza:Min. 95%Peso molecolare:566.48 g/mol[Ser25]-PKC (19-36) Substrate
Catalogue peptide; min. 95% purity
Formula:C93H159N35O25Peso molecolare:2,167.52 g/molRef: 3D-VAC-00658
Prodotto fuori produzioneGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SPeso molecolare:5,040.74 g/molRef: 3D-VAC-00849
Prodotto fuori produzioneRef: 3D-VAC-00032
Prodotto fuori produzione[Ser25]-PKC (19-31)
Catalogue peptide; min. 95% purity
Formula:C67H118N26O17Peso molecolare:1,559.85 g/molRef: 3D-VAC-00659
Prodotto fuori produzioneRef: 3D-VAC-00717
Prodotto fuori produzioneAldosterone Secretion Inhibiting Factor (1-35) (bovine)
Catalogue peptide; min. 95% purity
Formula:C164H278N58O45S4Peso molecolare:3,910.64 g/molRef: 3D-VAC-00235
Prodotto fuori produzione[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Formula:C59H89N17O14Peso molecolare:1,260.47 g/molRef: 3D-VAC-00511
Prodotto fuori produzione[Ala144]-PLP (139-151) A144-PLP(139-151)
Catalogue peptide; min. 95% purity
Formula:C64H99N19O17Peso molecolare:1,406.62 g/molRef: 3D-VAC-00493
Prodotto fuori produzione[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formula:C216H343N67O60Peso molecolare:4,838.43 g/molRef: 3D-VAC-00857
Prodotto fuori produzioneLys-(Tyr8)-Bradykinin
Catalogue peptide; min. 95% purity
Formula:C56H85N17O13Peso molecolare:1,204.41 g/molRef: 3D-VAC-00551
Prodotto fuori produzioneSarafotoxin S6d
Catalogue peptide; min. 95% purity
Formula:C112H167N27O34S5Peso molecolare:2,596 g/molRef: 3D-VAC-00294
Prodotto fuori produzionePACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
CAS:Catalogue peptide; min. 95% purity
Formula:C121H193N33O30SPeso molecolare:2,638.15 g/molRef: 3D-VAC-00014
Prodotto fuori produzioneAF-16 trifluoroacetate salt
CAS:AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.Formula:C71H119N25O25SPurezza:Min. 95%Peso molecolare:1,754.92 g/mol[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin
Catalogue peptide; min. 95% purity
Formula:C60H87N19O14Peso molecolare:1,298.48 g/molRef: 3D-VAC-00152
Prodotto fuori produzioneAbz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp
CAS:Please enquire for more information about Abz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C53H80N20O18Purezza:Min. 95%Peso molecolare:1,285.3 g/molAngiotensinogen (1-13)
Catalogue peptide; min. 95% purity
Formula:C79H116N22O17Peso molecolare:1,645.9 g/molRef: 3D-VAC-00344
Prodotto fuori produzioneH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SPeso molecolare:1,079.27 g/molRef: 3D-PP42775
Prodotto fuori produzioneH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Peso molecolare:966.18 g/molRef: 3D-PP48052
Prodotto fuori produzioneAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:855 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purezza:Min. 95%Peso molecolare:2,088.86 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purezza:Min. 95%Peso molecolare:1,287.65 g/mol
![[Arg0] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00699.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![[Ser25]-PKC (19-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00659.webp&w=3840&q=75)
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[Ala144]-PLP (139-151) A144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00493.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00152.webp&w=3840&q=75)
