Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30306 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-TPSDLNSML-OH
<p>Peptide H-TPSDLNSML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CDDRHDSGLDSMKDEE-OH
<p>Peptide H-CDDRHDSGLDSMKDEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRVYI-OH
<p>Peptide H-DRVYI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVVGAGGVGK-OH
<p>Peptide H-VVVGAGGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MLYQHLLPL-OH
<p>Peptide H-MLYQHLLPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRVGA-OH
<p>Peptide H-DRVGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STTAICATGL-OH
<p>Peptide H-STTAICATGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSLWNGPHL-OH
<p>Peptide H-CSLWNGPHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FVNEEALR-OH
Peptide H-FVNEEALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHNF-OH
Peptide H-VHNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASNENMETM -OH
Peptide H-ASNENMETM -OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WMHHNMLDI-OH
<p>Peptide H-WMHHNMLDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RQDILDLWI-OH
Peptide H-RQDILDLWI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLEHPIVVSGSW-OH
Peptide H-SLEHPIVVSGSW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STLPETTVV-OH
<p>Peptide H-STLPETTVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FASIR-OH
Peptide H-FASIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLLQTLR-OH
<p>Peptide H-VLLQTLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLLKFLAKV-OH
<p>Peptide H-SLLKFLAKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLDPER-OH
<p>Peptide H-TLDPER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASHEEVEGLVEK-OH
Peptide H-ASHEEVEGLVEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLLEFYLAM-OH
Peptide H-RLLEFYLAM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLETECPQYIR-OH
Peptide H-LLETECPQYIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IFGVTTLDIVR-OH
Peptide H-IFGVTTLDIVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLVQQEGQLEQQER-OH
Peptide H-HLVQQEGQLEQQER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HQAAMQMLKDTINEE-OH
<p>Peptide H-HQAAMQMLKDTINEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QYDPVAALFF-OH
<p>Peptide H-QYDPVAALFF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YQAIFDNTTSLTDK-OH
Peptide H-YQAIFDNTTSLTDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VQEEIDHVIGR-OH
<p>Peptide H-VQEEIDHVIGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ADRDQYELLCLDNTR-OH
<p>Peptide H-ADRDQYELLCLDNTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FTVTVPK-OH
Peptide H-FTVTVPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLEDAVNEGLEIVR-OH
Peptide H-NLEDAVNEGLEIVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TEWTSSNVMEERKIKV-OH
Peptide H-TEWTSSNVMEERKIKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VWLSAIWM-OH
<p>Peptide H-VWLSAIWM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLLMWITQCFLPVF-OH
<p>Peptide H-SLLMWITQCFLPVF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KSVTREDTGTYTC-OH
<p>Peptide H-KSVTREDTGTYTC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SELTQQLNALFQDK -OH
<p>Peptide H-SELTQQLNALFQDK -OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EEQYNSTYR-OH
<p>Peptide H-EEQYNSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLIQNSLTI-OH
Peptide H-RLIQNSLTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KSIHIGPGRAFYATG-OH
Peptide H-KSIHIGPGRAFYATG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIMAEIYK-OH
Peptide H-EIMAEIYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQTAAQR-OH
Peptide H-FQTAAQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HTLNQIDEVK-OH
<p>Peptide H-HTLNQIDEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YDVDTLDMVFLDHWK-OH
<p>Peptide H-YDVDTLDMVFLDHWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PLTFGWCYKLV-OH
<p>Peptide H-PLTFGWCYKLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLDEFMEGV-OH
Peptide H-FLDEFMEGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FDTLVGER-OH
Peptide H-FDTLVGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLFGAIAGFIEGGW-OH
<p>Peptide H-GLFGAIAGFIEGGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKQFEELTLGEFLKL-OH
<p>Peptide H-KKQFEELTLGEFLKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAVQNEVTL-OH
<p>Peptide H-GAVQNEVTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YSQAVPAVTEGPIPEVLK-OH
Peptide H-YSQAVPAVTEGPIPEVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLFNTVAVL-OH
Peptide H-SLFNTVAVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KHFGKDSNFPF-NH2
H-KHFGKDSNFPF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-TESTTEST-OH
Peptide H-TESTTEST-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DPKPIPGNW-OH
Peptide H-DPKPIPGNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YDGREHTV-OH
Peptide H-YDGREHTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAELVHFLL-OH
H-VAELVHFLL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-TNEFSLVNVNLQGCC-OH acetate salt
Custom research peptide; min purity 98%. For different specs please use the Peptide Quote ToolH-FIRHNPTGAVLFMGQINKP-OH
H-FIRHNPTGAVLFMGQINKP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C98H154N28O24S1Peso molecolare:2,140.54 g/molH-AFLGERVTL-OH
Peptide H-AFLGERVTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVMEKNIVL-OH
Peptide H-AVMEKNIVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NAPYLPSCL-OH
Peptide H-NAPYLPSCL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLFGEPKRL-OH
Peptide H-FLFGEPKRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSFFLYSKLTVD-OH
<p>Peptide H-GSFFLYSKLTVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
H-EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C140H214N36O43Peso molecolare:3,089.45 g/molH-GPRPK-OH
Peptide H-GPRPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTIWMPENPRPGTPCDIFTNSRGKRASNG-NH2
CAS:Peptide H-YTIWMPENPRPGTPCDIFTNSRGKRASNG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH
H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-GVVPHDFRI-OH
H-GVVPHDFRI-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C48H74N14O12Peso molecolare:1,039.2 g/molH-GVLTLNFQ-OH
Peptide H-GVLTLNFQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MMMMMMMMMMMM-OH
<p>Peptide H-MMMMMMMMMMMM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KWKLFKKIGAVLKVL-NH2
Peptide H-KWKLFKKIGAVLKVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C89H152N22O15Peso molecolare:1,770.32 g/molH-LEKARGSTY-OH
Peptide H-LEKARGSTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH
<p>Peptide H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSCSSLMDKECVYFCHLDIIW-OH
H-CSCSSLMDKECVYFCHLDIIW-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C109H163N25O32S5Peso molecolare:2,495.97 g/molH-GTVGGYFLAGR-OH
<p>Peptide H-GTVGGYFLAGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APENAYQAY-OH
Peptide H-APENAYQAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EH-OH
<p>Peptide H-EH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLSSLGLNAV-OH
Peptide H-KLSSLGLNAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQSIQPFISR-OH
<p>Peptide H-GQSIQPFISR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGLSKGCFGLKLDRIGSMSGLGC-NH2
CAS:H-YGLSKGCFGLKLDRIGSMSGLGC-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C102H166N28O30S3Peso molecolare:2,360.8 g/molH-QSRGDENRGW-OH
<p>Peptide H-QSRGDENRGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KVDDTFYYV-OH
<p>Peptide H-KVDDTFYYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RCVCRRGVCRCVCTRGFC-OH
H-RCVCRRGVCRCVCTRGFC-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-GCTVCG-OH
Peptide H-GCTVCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PPPPP-OH
Peptide H-PPPPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH
<p>H-EGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-LPPHDITPY-OH
<p>Peptide H-LPPHDITPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKLITFILKKTREK-OH
Peptide H-KKLITFILKKTREK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STKKLSECLKRIGDELDSNM-OH
H-STKKLSECLKRIGDELDSNM-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-TEMP-OH
Peptide H-TEMP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DSQVHSGVQVEGRRGH-OH
<p>Peptide H-DSQVHSGVQVEGRRGH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RQKRILVNL-OH
Peptide H-RQKRILVNL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QTALVELVK-OH
Peptide H-QTALVELVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLSLEEIQK-OH
Peptide H-DLSLEEIQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AELVHFLLL-OH
Peptide H-AELVHFLLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISIDVNNNDIK-OH
<p>Peptide H-ISIDVNNNDIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WSPGGQML-OH
Peptide H-WSPGGQML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SDYGERLI-OH
<p>Peptide H-SDYGERLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPRRNRWSKIWKKVVTVFS-NH2
Peptide H-LPRRNRWSKIWKKVVTVFS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SELEIKRY-OH
Peptide H-SELEIKRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
