Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30306 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-DFTPAAQAAFQK-OH
Peptide H-DFTPAAQAAFQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KSAPSTGGVK-OH
Peptide H-KSAPSTGGVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IIATDIQTK-OH
Peptide H-IIATDIQTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WYQSIR-OH
Peptide H-WYQSIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPETER-OH
Peptide H-TPETER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLFRAVITK-OH
<p>Peptide H-SLFRAVITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GQAEPDRAHYNIVTF-OH
Peptide H-GQAEPDRAHYNIVTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2
H-CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C145H240N44O48S2Peso molecolare:3,431.9 g/molH-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C192H295N61O60SPeso molecolare:4,449.9 g/molH-YYQGSCYIL-OH
<p>Peptide H-YYQGSCYIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLWEWASVR-OH
<p>Peptide H-YLWEWASVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YFDSFGDLSSASAIMGNAK-OH
Peptide H-YFDSFGDLSSASAIMGNAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LHGGSPWPPCQYR-OH
<p>Peptide H-LHGGSPWPPCQYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KHFGKDSNFPFGT-OH
H-KHFGKDSNFPFGT-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-RERQR-OH
Peptide H-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLLTSSKGQLQK-OH
<p>Peptide H-SLLTSSKGQLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IPYV-OH
<p>Peptide H-IPYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KMLKEMGEV-OH
Peptide H-KMLKEMGEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IVGGWECEK-OH
<p>Peptide H-IVGGWECEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CFFQNCPKG-NH2
CAS:H-CFFQNCPKG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C46H65N13O11S2Peso molecolare:1,040.23 g/molH-IGI-OH
Peptide H-IGI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLLKLTPLL-OH
Peptide H-FLLKLTPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TEAFIPFSLGK-OH
<p>Peptide H-TEAFIPFSLGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CASDAKAYDTEVHNV-OH
H-CASDAKAYDTEVHNV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-TYFPHFDVSHGSAQVK-OH
Peptide H-TYFPHFDVSHGSAQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSKKPVPIIYCNRRTGKCQRM-OH
<p>Peptide H-GSKKPVPIIYCNRRTGKCQRM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPFPIIV-OH
Peptide H-GPFPIIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RKIYDLIEL-OH
Peptide H-RKIYDLIEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SNLELLR-OH
<p>Peptide H-SNLELLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGIGKIGDFIKKAIAKYKN-OH
H-AGIGKIGDFIKKAIAKYKN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-KRPPIFIRRL-OH
Peptide H-KRPPIFIRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLPSIPVHPI-OH
<p>Peptide H-GLPSIPVHPI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NFLINETAR-OH
Peptide H-NFLINETAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TITLEVEPSDTIENVK-OH
<p>Peptide H-TITLEVEPSDTIENVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STHVDIRTLEDLLMG-OH
Peptide H-STHVDIRTLEDLLMG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IDEALER-OH
Peptide H-IDEALER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HQKLVFFA-NH2
Peptide H-HQKLVFFA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPNAGQMQPVK-OH
<p>Peptide H-IPNAGQMQPVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APAMFNIR-OH
<p>Peptide H-APAMFNIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SCSSCPLSK-OH
<p>Peptide H-SCSSCPLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLPAPITR-OH
<p>Peptide H-DLPAPITR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SESIKKKVL-OH
<p>Peptide H-SESIKKKVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2
H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-NAVEVLKR-OH
Peptide H-NAVEVLKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLWAQCVQL-OH
Peptide H-KLWAQCVQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EW-OH
<p>Peptide H-EW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TITLEVESSDTIDNVK-OH
Peptide H-TITLEVESSDTIDNVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGMQIFVK-OH
<p>Peptide H-GGMQIFVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIVLTQSPATLSLSP-OH
H-EIVLTQSPATLSLSP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-RHPDYSVVLLLR-OH
<p>Peptide H-RHPDYSVVLLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RADEEQQQALSSQMGF-OH
H-RADEEQQQALSSQMGF-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-AALEDTLAETEAR-OH
Peptide H-AALEDTLAETEAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGSC-OH
Peptide H-GGSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MDAEFRHD-NH2
Peptide H-MDAEFRHD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SESGQFHAF-OH
<p>Peptide H-SESGQFHAF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FYLYDSETK-OH
<p>Peptide H-FYLYDSETK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRRRRRRRRRRRRRRRRR-OH
<p>Peptide H-RRRRRRRRRRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLVDLLWLL-OH
Peptide H-LLVDLLWLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPVDLAEELGHR-OH
<p>Peptide H-LPVDLAEELGHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALIVFWKYR-OH
Peptide H-ALIVFWKYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQTAAQR-OH
Peptide H-FQTAAQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FMVFLQTHI-OH
Peptide H-FMVFLQTHI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALWMTLLKKVLKAAAKAALNAVLVGANA-OH
H-ALWMTLLKKVLKAAAKAALNAVLVGANA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C132H229N35O32SPeso molecolare:2,850.55 g/molH-LVVVGACGVGK-OH
<p>Peptide H-LVVVGACGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPRPV-OH
Peptide H-GPRPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HNLFEPEDTGQR-OH
Peptide H-HNLFEPEDTGQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PETERT-OH
Peptide H-PETERT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLQQNWWTL-OH
Peptide H-YLQQNWWTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SAYGEPRKL-OH
Peptide H-SAYGEPRKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RGPESRLL-OH
<p>Peptide H-RGPESRLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPEPLPQGQLTAY-OH
Peptide H-LPEPLPQGQLTAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AKKVRRAIEQLAAMD-OH
Peptide H-AKKVRRAIEQLAAMD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALDGGNKHFL-OH
<p>Peptide H-ALDGGNKHFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EGATPQDLNMMLNIV-OH
<p>Peptide H-EGATPQDLNMMLNIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGPRGENEGPDS-OH
<p>Peptide H-YGPRGENEGPDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQTGIHVRV-OH
Peptide H-LQTGIHVRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MGSLEMVPM-OH
Peptide H-MGSLEMVPM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-N-methyl-L-leucine
CAS:Formula:C22H25NO4Purezza:>98.0%(T)(HPLC)Colore e forma:White to Almost white powder to crystalPeso molecolare:367.45H-NAPPEPVPPPR-OH
H-NAPPEPVPPPR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-FALPQYLK-OH
<p>Peptide H-FALPQYLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C49H74N10O11Peso molecolare:979.18 g/molH-LIEDNEYTAR-OH
<p>Peptide H-LIEDNEYTAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QQNWWTLLV-OH
<p>Peptide H-QQNWWTLLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FFVPPFQQSPR-OH
Peptide H-FFVPPFQQSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRHRILDIYL-OH
Peptide H-RRHRILDIYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLLDLHSYL-OH
Peptide H-YLLDLHSYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSSPSMPEL-OH
Peptide H-TSSPSMPEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALKATFSGFKKEQRRLGCC-OH acetate salt
Custom research peptide; min purity 98%. For different specs please use the Peptide Quote ToolH-AASLDGFYNGR-OH
Peptide H-AASLDGFYNGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIDTVLPNK-OH
Peptide H-EIDTVLPNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLVVVGAGGVGK-OH
Peptide H-KLVVVGAGGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SELEEQLTPVAEETR-OH
<p>Peptide H-SELEEQLTPVAEETR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDKNKDPLNETV-OH
<p>Peptide H-LDKNKDPLNETV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VEITPYKPTW-OH
Peptide H-VEITPYKPTW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RSFTLASSETGVG-OH
Peptide H-RSFTLASSETGVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FNLAGNHEQEFLR-OH
<p>Peptide H-FNLAGNHEQEFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIMAEIYK-OH
Peptide H-EIMAEIYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C194H295N55O57Peso molecolare:4,309.81 g/molH-QEEEEDEDEER-OH
Peptide H-QEEEEDEDEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ESDPIVAQY-OH
Peptide H-ESDPIVAQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTFASLSELHCDK-OH
Peptide H-GTFASLSELHCDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-N-methyl-L-leucine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3B%2Fthumb-webp%2FF1028.webp&w=3840&q=75)
