Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30311 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
CLIP (86-100) (TFA) (648881-58-7 free base)
CLIP (86-100) TFA is a fragment of the invariant chain peptide in the HLA-II groove.Formula:C74H129F3N20O21S3Purezza:98%Colore e forma:SolidPeso molecolare:1788.13Preprosomatostatin (25-34)
CAS:Preprosomatostatin (25-34) is a peptide.Formula:C52H83N17O15Purezza:98%Colore e forma:SolidPeso molecolare:1186.32immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]
Human and mouse Ig light chain variable region fragment binds antigens; part of B cell Ig molecule with heavy and light chains.Formula:C54H83N13O13Purezza:98%Colore e forma:SolidPeso molecolare:1122.32type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]
Type I human hair keratin has 9 members in 3 groups: A (hHa1, hHa3-I/II, hHa4), B (hHa7, hHa8), and disparate C (hHa2, hHa5, hHa6).Formula:C47H77N13O15Purezza:98%Colore e forma:SolidPeso molecolare:1064.19Ref: TM-TP2188
1mgPrezzo su richiesta5mgPrezzo su richiesta10mgPrezzo su richiesta25mgPrezzo su richiestaβ-catenin peptide
CAS:<p>β-catenin peptide,(βCATp) is a naturally occurring self-peptide presented by Kb that very efficiently mediates positive selection of the OT-I thymocytes.</p>Formula:C49H76N12O15Purezza:98%Colore e forma:SolidPeso molecolare:1073.2Tos-Gly-Pro-Arg-ANBA-IPA acetate
CAS:Tos-Gly-Pro-Arg-ANBA-IPA (acetate) is a peptide substrate for luminescence measurement.Formula:C32H45N9O10SPurezza:98%Colore e forma:SolidPeso molecolare:747.82Palmitoyl dipeptide-7
CAS:Palmitoyl dipeptide-7 is a peptide.Formula:C26H51N3O5Purezza:98%Colore e forma:SolidPeso molecolare:485.7Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Purezza:98%Colore e forma:SolidPeso molecolare:3692.15CGRP(83-119), rat
<p>Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor.</p>Formula:C162H262N50O52S2Purezza:98%Colore e forma:SolidPeso molecolare:3806.3cAC 253
<p>Amylin antagonist AMY3, IC50 0.3 μM, shields neurons from Aβ toxicity, brain-penetrant, boosts memory, lowers Aβ plaques in Alzheimer's mice.</p>Formula:C126H202N42O40S2Purezza:98%Colore e forma:SolidPeso molecolare:3009.36LLO (91-99) acetate
<p>LLO (91-99) acetate: an exotoxin, class I MHC T-cell epitope, crucial for T-cell immunity induction.</p>Formula:C49H71N11O19Purezza:98%Colore e forma:SolidPeso molecolare:1118.15Agavoside H
CAS:<p>Agavoside H is a biochemical.</p>Formula:C68H112O37Purezza:98%Colore e forma:SolidPeso molecolare:1521.607Lliumoside C
CAS:Lliumoside C is a bioactive chemical.Formula:C63H104O31Purezza:98%Colore e forma:SolidPeso molecolare:1357.494Agavoside E
CAS:<p>Agavoside E is a biochemical.</p>Formula:C62H100O31Purezza:98%Colore e forma:SolidPeso molecolare:1341.451Neuropeptide Y (scrambled) Acetate
<p>Neuropeptide Y (scrambled) Acetate (Pro-Neuropeptide Y (scrambled) Acetate) is a scrambled peptide of Neuropeptide Y that has been implicated in Alzheimer's</p>Formula:C190H287N55O57Purezza:99.07% - 99.57%Colore e forma:SolidPeso molecolare:4251.12Cyclo(Phe-Pro) acetate(14705-60-3 free base)
Cyclo(Phe-Pro) acetate(14705-60-3 free base), known as a secondary metabolite of some bacteria and fungi, is also produced by Vibrio vulnificus.Formula:C16H20N2O4Purezza:98%Colore e forma:SolidPeso molecolare:304.35Bz-Ala-Arg
CAS:Bz-Ala-Arg, a dipeptide, serves as a spectrophotometric substrate (0.4 M pyridine formate, pH 4.25) for human pancreatic carboxypeptidase B and plasmaFormula:C16H23N5O4Purezza:98%Colore e forma:SolidPeso molecolare:349.38Dermcidin-1L (human)
CAS:Dermcidin-1L (human), an antibiotic peptide secreted by sweat glands, exhibits antimicrobial activity and is utilized in the research of inflammatory skinFormula:C210H359N57O71Purezza:98%Colore e forma:SolidPeso molecolare:4818.44Aam-KTX
Aam-KTX, a toxic peptide sourced from Mesobuthus eupeus scorpion venom, acts as a selective K_v channel inhibitor, exhibiting IC_50 values of 1.1 nM for K_v1.3Formula:C174H288N58O48S7Purezza:98%Colore e forma:SolidPeso molecolare:4184.96μ-Conotoxin SxIIIC
<p>μ-Conotoxin SxIIIC, an irreversible NaV channel inhibitor, is derived from Conus striolatus and is useful in researching neurological disorders, including</p>Formula:C90H142N42O27S6Purezza:98%Colore e forma:SolidPeso molecolare:2436.75Slotoxin
Slotoxin, a peptide extracted from the venom of the Centruroides noxius Hoffmann scorpion, inhibits high-conductance calcium-activated potassium channels with aFormula:C177H275N47O50S7Purezza:98%Colore e forma:SolidPeso molecolare:4085.82ω-Conotoxin SO3
CAS:ω-Conotoxin SO3 is an analgesic peptide that functions as an antagonist to N-type voltage-sensitive calcium channels, and can be isolated from the venom ofFormula:C100H166N36O31S6Purezza:98%Colore e forma:SolidPeso molecolare:2561Thrombin receptor peptide ligand
CAS:Thrombin receptor peptide ligand, a thrombin receptor antagonist, serves as an antithrombotic agent [1].Formula:C33H54N10O8Purezza:98%Colore e forma:SolidPeso molecolare:718.84Interphotoreceptor retinoid-binding protein(668-687)
CAS:Interphotoreceptor retinoid-binding protein(668-687)is an amino acid residue of human retinoid-binding protein(IRBP) 668-687, which can induce uveitis.Formula:C91H151N25O32Purezza:98%Colore e forma:SolidPeso molecolare:2107.32Dc1a
Dc1a, a toxin isolated from the desert bush spider Diguetia canities [1], potently facilitates the opening of the German cockroach Na v channel (BgNa v 1).Formula:C276H414N76O84S8Purezza:98%Colore e forma:SolidPeso molecolare:6397.22Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa
CAS:FMRF is a 4-residue neuropeptide from Helix aspersa snail muscles.Formula:C44H61N11O10Purezza:98%Colore e forma:SolidPeso molecolare:904.02Hainantoxin-IV
CAS:Hainantoxin-IV acts as a specific antagonist for tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels, with His28 and Lys32 being critical residues forFormula:C166H257N53O50S6Purezza:98%Colore e forma:SolidPeso molecolare:3987.53BmK-M1
BmK-M1, a scorpion-derived toxin, consists of a 64-amino acid polypeptide stabilized by four disulfide bridges.Formula:C313H467N91O91S8Purezza:98%Colore e forma:SolidPeso molecolare:7217.13Parasin I (TFA)(219552-69-9,free)
Parasin I (TFA) is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity[1].Formula:C82H154N34O24·C2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:2114.33Pterinotoxin-2
Pterinotoxin-2 is a peptide toxin that acts as a sodium channel inhibitor [1].Formula:C156H237N45O42S7Purezza:98%Colore e forma:SolidPeso molecolare:3639.28Phlo1a
Phlo1a (μ-TrTx-Phlo1a), a 35-amino acid peptide toxin, demonstrates a weak inhibitory effect on Nav1.2 and Nav1.5 channels [1].Formula:C178H262N52O49S6Purezza:98%Colore e forma:SolidPeso molecolare:4106.69π-TRTX-Hm3a
π-TRTX-Hm3a, a 37-amino acid peptide derived from the venom of the Togo starburst tarantula (Heteroscodra maculata), selectively inhibits the acid-sensing ionFormula:C186H290N56O49S6Purezza:98%Colore e forma:SolidPeso molecolare:4287.03FITC-Ahx-Gly-Arg-Gly-Asp-Ser-Pro
CAS:FITC-Ahx-Gly-Arg-Gly-Asp-Ser-Pro, also known as FITC-linked GRGDSP, is a fluorescent peptide with integrin inhibitory properties.Formula:C49H59N11O16SPurezza:98%Colore e forma:SolidPeso molecolare:1090.12Phrixotoxin-1
CAS:Phrixotoxin 1, a specific peptide inhibitor of Kv4 potassium channels, originates from the venom of the theraphosid spider Phrixotrichus auratus [1] [2].Formula:C156H246N44O37S7Purezza:98%Colore e forma:SolidPeso molecolare:3554.35Mambalgin-3
Mambalgin-3, an acid-sensitive ion channel 1 (ASIC1) inhibitor, has potential applications in analgesia research [1].Formula:C274H433N85O83S10Purezza:98%Colore e forma:SolidPeso molecolare:6566.54PKCβII Peptide Inhibitor I
CAS:PKCβII Peptide Inhibitor I, a specific PKCβII inhibitor, exhibits cardioprotective properties in a rat cardiac ischemia/reperfusion injury model and mitigatesFormula:C61H94N12O19Purezza:98%Colore e forma:SolidPeso molecolare:1299.47Super Fluor 647, SE
Super Fluor 647, SE labels proteins and peptides for bright cellular detection without self-quenching.Purezza:98%Colore e forma:SolidPeso molecolare:N/APACE4 Inhibitory peptide C23
CAS:<p>PACE4 Inhibitory peptide C23 (Compound C23) is an effective peptidomimetic inhibitor known to act against PACE4. It exhibits antiproliferative effects on PCa cell lines, with a Ki of 5 nM, and IC50 values of 25 μM and 40 μM for DU145 and LNCaP cells, respectively. Additionally, PACE4 Inhibitory peptide C23 suppresses tumor growth in LNCaP xenograft mice.</p>Formula:C51H90N14O8Colore e forma:SolidPeso molecolare:1027.35PKCε inhibitor peptide,myristoylated
<p>Myristoylated PKCε inhibitor peptide (Myr-PKCε-) is a cell-permeable inhibitor consisting of a peptide linked to myristic acid that specifically inhibits</p>Formula:C51H91N9O14Purezza:98%Colore e forma:SolidPeso molecolare:1054.32Phytochelatin 4
CAS:Phytochelatin 4 (PC 4) a heavy metal detoxifier/chelator consisting of 4 units of glu - cys , tolerant to Cd (cadmium), ultimately sequestered in the vesicle.Formula:C34H53N9O18S4Purezza:95.98%Colore e forma:SolidPeso molecolare:1004.09CGGRGD TFA (1260223-44-6 free base)
CGGRGD TFA synthesized via solid-phase synthesis; PCL fibers aminolysed with amino 2-cyanobenzothiazole, then CBT added.Formula:C21H34F3N9O11SPurezza:98%Colore e forma:SolidPeso molecolare:677.61SVS-1 peptide
CAS:SVS-1 peptide is an anticancer peptide that selectively targets cancer cells through electrostatic interactions, disrupting the cell membrane structure and inducing cell death. Unlike antimicrobial peptides, the activity of SVS-1 peptide occurs before the complete neutralization of membrane charges.Formula:C97H183N27O19Colore e forma:SolidPeso molecolare:2031.66Arg-Ala-Asp-Cys acetate
Arg-Ala-Asp-Cys acetate is a tetrapeptide compound.Formula:C18H33N7O9SPurezza:95.32%Colore e forma:SolidPeso molecolare:523.56Palmitoyl tripeptide-38
CAS:Palmitoyl tripeptide-38 is a bioactive peptide renowned for its anti-aging properties [1].Formula:C33H65N5O7SPurezza:98%Colore e forma:SolidPeso molecolare:675.96EGFR Peptide (human, mouse) TFA
EGFR peptide, a PKC peptide substrate, mirrors an amino acid sequence from EGFR's intracellular region and serves to gauge PKC activity in primary bovineFormula:C46H91N21O10·XCF3COOHColore e forma:SolidPeso molecolare:1098.35δ-Theraphotoxin-Hm1a toxin
δ-Theraphotoxin-Hm1a is a selective NaV1.1 activator that induces pain and touch sensitivity, with potential applications in irritable bowel syndrome research [Formula:C170H240N48O53S6Purezza:98%Colore e forma:SolidPeso molecolare:3996.4QL9
CAS:QL9 is derived from the enzyme 2-oxoglutarate dehydrogenase and belongs to the endogenous peptide repertoire of all H-2d APCs.Formula:C52H74N10O14Purezza:98%Colore e forma:SolidPeso molecolare:1063.21Ac-LETD-AFC
CAS:Ac-LETD-AFC is a fluorescent substrate that can be specifically cleaved by caspase-8. λEx(nm) of Ac-LETD-AFC is 400 nm and λEm is 505 nm.Formula:C31H38F3N5O12Purezza:99.67%Colore e forma:SolidPeso molecolare:729.65Peptide C105Y
CAS:C105Y, a synthetic peptide mimicking alpha1-antitrypsin residues 359-374, boosts DNA nanoparticle gene expression.Formula:C97H148N20O23SPurezza:98%Colore e forma:SolidPeso molecolare:1994.4α-Gliadin (43-49)
CAS:alpha-Gliadin (43-49) is a Gliadian sequence peptide. It could induce leukocyte migration inhibition but be blocked by naloxone.Formula:C43H57N9O11Purezza:98%Colore e forma:SolidPeso molecolare:875.97Ac-FEID-CMK TFA
Ac-FEID-CMK TFA is a zebrafish GSDMEb-derived peptide inhibitor that acts by inhibiting the caspy2-mediated atypical inflammatory vesicle pathway.Formula:C29H38ClF3N4O11Purezza:95%Colore e forma:SolidPeso molecolare:711.08N-Oleoyl Glutamine
CAS:<p>N-Oleoyl Glutamine (Oleoyl-L-glutamine) antagonizes TRPV1 of the transient receptor potential (TRP) calcium channel.</p>Formula:C23H42N2O4Purezza:99.61%Colore e forma:SolidPeso molecolare:410.59ω-Tbo-IT1
ω-Tbo-IT1, a peptide toxin extracted from the venom of Tibellus oblongus, functions as an inhibitor of insect calcium channels [1].Formula:C171H285N61O53S9Purezza:98%Colore e forma:SolidPeso molecolare:4332.05Somatostatin 1-28
CAS:Somatostatin receptor agonist, derived from the post-translational cleavage of prosomatostatin.Formula:C137H207N41O39S3Purezza:98%Colore e forma:SolidPeso molecolare:3149GTP-Binding Protein Fragment, G α
Three GTP-binding protein alpha subunits stay membrane-bound post-activation and are cleaved by trypsin, releasing fragments; previously thought cytoplasmic.Formula:C66H118N20O23S2Purezza:98%Colore e forma:SolidPeso molecolare:1623.89N,N''-Carbonyldiimidazole
CAS:Formula:C7H6N4OPurezza:(Titration) ≥ 97.0%Colore e forma:White, off-white or pale yellow powder or crystalsPeso molecolare:162.15Foxy-5 Ammonium Salt
Foxy-5 Ammonium Salt, a WNT5A mimetic, blocks epithelial cancer cell migration without β-catenin impact and curbs prostate cancer spread.Formula:C26H46N7O12S2Purezza:97.70%Colore e forma:SolidPeso molecolare:712.26Ref: TM-TP1565L1
1mg96,00€5mg304,00€10mg454,00€25mg743,00€50mg1.035,00€100mg1.396,00€1mL*10mM (DMSO)325,00€Arginase
CAS:Arginase (L-Arginine amidinase) is a key hydrolytic enzyme in the urea cycle, which hydrolyzes L-arginine into urea and L-ornithine.Colore e forma:SolidTertiapin-Q acetate
Tertiapin-Q acetate is a bee toxin derivative that inhibits BK-type K(+) channels in a concentration-dependent manner.Formula:C108H179N35O26S4Purezza:96.44%Colore e forma:SolidPeso molecolare:2512.06IP3RPEP6
CAS:IP3RPEP6 serves as a competitive inhibitor of IP3R. Its IC50 values for IP3R1, IP3R2, and IP3R3 are 9.0 μM, 3.9 μM, and 4.3 μM, respectively. This compound does not affect ryanodine receptors and Cx43 hemichannels, and it is capable of modulating intracellular calcium signaling.Formula:C49H79N15O24Colore e forma:SolidPeso molecolare:1262.24CP61
CAS:CP61, a cyclic peptide, functions as a dual inhibitor of CtBP1/CtBP2. It binds to CtBP1 with an affinity of 3 μM and inhibits both heterodimerization and homodimerization of CtBP2 with an IC50 value of 19 μM. CP61 shows promise for cancer research.Formula:C50H73N13O12SColore e forma:SolidPeso molecolare:1080.26BDS I
Potent and reversible Kv3.4 potassium channel blocker (IC50 = 47 nM); also attenuates inactivation of sodium currents by acting on Nav1.7 and Nav1.3 channels.Formula:C210H297N57O56S6Purezza:98%Colore e forma:SolidPeso molecolare:4708.37Valylvaline
CAS:Valylvaline (Val-val) is a dipeptide compound that can be used for protein synthesis.Formula:C10H20N2O3Purezza:99.67%Colore e forma:SolidPeso molecolare:216.281,3-Dimethyl-3,4,5,6-tetrahydro-2(1H)-pyrimidinone
CAS:Formula:C6H12N2OPurezza:≥ 98.0%Colore e forma:Colourless to light yellow liquidPeso molecolare:128.18S1b3inL1
CAS:S1b3inL1 is a macrocylcic peptide inhibitor of the SARS-CoV-2 spike protein. It binds with high affinity to a conserved site on the spike protein, effectively suppressing the infection of various SARS-CoV-2 variants. S1b3inL1 exhibits antiviral activity.Formula:C103H158N30O24SColore e forma:SolidPeso molecolare:2232.61Substance P(1-4) Acetate
Substance P(1-4) Acetate is a neurokinin receptor (NK-R) antagonist, inhibiting the formation of PV EEC.Formula:C24H44N8O7Purezza:99.84%Colore e forma:SolidPeso molecolare:556.66Bevonescein
CAS:Bevonescein (ALM-488) is a fluorescent peptide that selectively binds to human neurons, serving as a diagnostic imaging agent [1] [2].Formula:C112H144N22O32Colore e forma:SolidPeso molecolare:2310.47Extracellular Death Factor TFA
Extracellular death factor TFA (EDF TFA) is a linear pentapeptide that communicating cells produce and release, which activates the cell death pathway.Purezza:98.77%Colore e forma:Odour SolidACTH (1-13)
CAS:ACTH (1-13), a 13-amino acid peptide, protects rats' stomachs from ethanol damage; it’s a stress-response hormone from the pituitary.Formula:C75H106N20O19SPurezza:98%Colore e forma:SolidPeso molecolare:1623.836-CR110 Single isomer
CAS:<p>6-CR110 Single isomer is a rhodamine-class green fluorescent dye with ex/em=499/525 nm for DNA or protein labelling and cell staining.</p>Formula:C21H15N2O5ClPurezza:98%Colore e forma:SolidPeso molecolare:410.81Sarasinoside B1
CAS:Sarasinoside B1 is a norlanostane-triterpenoid oligoglycoside from the Palauan marine sponge Asteropus sarasinosum.Formula:C61H98N2O25Purezza:98%Colore e forma:SolidPeso molecolare:1259.444Arfalasin
CAS:Arfalasin is a bioactive chemical.Formula:C48H67N13O11Purezza:98%Colore e forma:SolidPeso molecolare:1002.13Cucumarioside A6-2
CAS:Cucumarioside A6-2 is a triterpene glycoside.Formula:C59H92NaO32S2Purezza:98%Colore e forma:SolidPeso molecolare:1400.46HIF-1 α (556-574) TFA (1201633-99-9 free base)
19-mer HIF-1α fragment critical for oxygen response; binds VHL via crucial proline 564 for gene regulation.Formula:C103H151D2F3N20O36S2Purezza:98%Colore e forma:SolidPeso molecolare:2368.62SPACE peptide
SPACE peptide is a skin penetrating peptide that facilitates the transfer of molecules through the skin.Formula:C40H63N15O17S2Purezza:98%Colore e forma:SolidPeso molecolare:1090.17Prion Protein 106-126 (human)
CAS:Prion peptide fragment that exhibits neurotoxicityFormula:C80H138N26O24S2Purezza:98%Colore e forma:SolidPeso molecolare:1912.24Flagelin 22 TFA (304642-91-9 free base)
<p>Flagelin 22 TFA (Flagellin 22 TFA), a fragment of bacterial flagellin, is an effective elicitor in both plants and algae.</p>Formula:C95H163F3O36N32Purezza:98%Colore e forma:SolidPeso molecolare:2386.53Disomotide
CAS:Disomotide is an oligopeptide for the treatment of melanoma.Formula:C47H74N10O14SPurezza:98%Colore e forma:SolidPeso molecolare:1035.2WL 47 - dimer
High affinity caveolin-1 (CAV1) ligand (Kd = 23 nM); disrupts caveolin-1 oligomers. Exhibits selectivity for CAV1 over BSA, casein and HEWL.Formula:C80H130N24O18S4Purezza:98%Colore e forma:SolidPeso molecolare:1844.3C14TKL-1
potent agonist for NK1 receptorsFormula:C63H98N20O13S2Purezza:98%Colore e forma:SolidPeso molecolare:1406.7Pentasarcosyl angiotensin II
CAS:Pentasarcosyl angiotensin II is a synthetic analog of angiotensin II.Formula:C65H96N18O17Purezza:98%Colore e forma:SolidPeso molecolare:1401.57TAT 2-4
CAS:TAT 2-4, an HIV-1 Tat protein peptide, efficiently delivers diverse cargoes, from particles to biomolecules.Formula:C132H240N66O29Purezza:98%Colore e forma:SolidPeso molecolare:3215.74Neuropeptide S (human) (TFA)
Neuropeptide S human (TFA) is a potent endogenous neuropeptide S receptor agonist (EC50=9.4 nM).Formula:C95H156N31F3O30SPurezza:98%Colore e forma:SolidPeso molecolare:2301.52α-1 antitrypsin fragment 235-243 [Homo sapiens]/[Papio hamadryas]/[Cercopithecus aethiops]
Protease inhibitorFormula:C51H85N11O12SPurezza:98%Colore e forma:SolidPeso molecolare:1076.35IRL-1620 TFA (142569-99-1 free base)
<p>IRL-1620 (TFA) is a potent selective endothelin receptor B (ETB) agonist with a Ki value of 16pm.</p>Formula:C88H118F3N17O29Purezza:98%Colore e forma:SolidPeso molecolare:1934.97Fibrinopeptide A, human TFA
CAS:Human fibrinopeptide A, a 16-residue peptide, is thrombin-cleaved from fibrinogen's Aα chain NH2-terminus, aiding fibrin polymerization.Formula:C67H99F6N19O30Purezza:98%Colore e forma:SolidPeso molecolare:1764.6Glipentide
CAS:Glieptide, a second-generation sulfonylurea, promotes the accumulation of fructose 2, 6-diphosphate in liver cells.Formula:C22H27N3O5SPurezza:98%Colore e forma:SolidPeso molecolare:445.53MCH (salmon) TFA (87218-84-6 free base)
MCH, a 19 amino acid peptide in the hypothalamus, regulates arousal, behavior, and food intake in mammals.Formula:C91H140F3N27O26S4Purezza:98%Colore e forma:SolidPeso molecolare:2213.5PEN-221
CAS:PEN-221 targets SSTR2; it's a cytotoxic conjugate with DM1 and Tyr3-octreotate, IC50 of 10 nM.Formula:C83H109ClN14O20S4Purezza:98%Colore e forma:SolidPeso molecolare:1786.55Adipokinetic Hormone (AKH) (24-32), locust
CAS:Adipokinetic Hormone (AKH) (24-32), locust is a peptide hormone isolated from locusts.Formula:C54H74N14O15Purezza:98%Colore e forma:SolidPeso molecolare:1159.27TfR-T12 acetate
TfR-T12 acetate is a peptide binding to the transferrin receptor (TfR) and is subsequently internalized into TfR-expressing cells.Formula:C73H103N19O17SPurezza:97%Colore e forma:SolidPeso molecolare:1550.78Mini Gastrin I, human TFA (54405-27-5 free base)
Mini Gastrin I, human (TFA) is short for human Gastrin. It is a mother peptide composed of 5-17 amino acids.Formula:C76H100F3N15O28SPurezza:98%Colore e forma:SolidPeso molecolare:1760.75Thelenotoside B
CAS:Thelenotoside B is a triterpene tetraglycoside.Formula:C55H88O23Purezza:98%Colore e forma:SolidPeso molecolare:1117.286Foxy-5 acetate
<p>Foxy-5 acetate: Wnt 5A agonist, inhibits cancer cell migration/invasion, boosts calcium signaling, doesn't activate β-catenin.</p>Formula:C28H46N6O14S2Purezza:98%Colore e forma:SolidPeso molecolare:754.83SDKPDMAEIEKFDKSK acetate
<p>SDKPDMAEIEKFDKSK acetate, a Thymosin β4 derivative, blocks Akt to inhibit PDGF-BB-driven fibrogenesis and HSC proliferation/migration.</p>Formula:C82H134N20O31SPurezza:99.04%Colore e forma:SolidPeso molecolare:1928.12NH2-KLGADTDGEQDQHMTYGGQ-COOH
NH2-QGGYTMHQDQEGDTDAGLK-COOH is a synthetic peptide chain consisting of a primary amine group attached to lysine and a carboxyl group attached to glutamine.Formula:C83H127N25O34SPurezza:98%Colore e forma:SolidPeso molecolare:2051.11RETF-4NA
CAS:chymase substrate peptideFormula:C32H43N9O10Purezza:98%Colore e forma:SolidPeso molecolare:713.74Platelet Factor 4 (58-70), human
CAS:Platelet Factor 4 (58-70), human is a polypeptide based on the 58-70 amino acid sequence of Platelet Factor 4 (pf-4) residues.Formula:C76H133N17O18Purezza:98%Colore e forma:SolidPeso molecolare:1572.97Splenopentin diacetate
CAS:Splenopentin diacetate (Splenin pentapeptide (32-36)) is a synthetic immunomodulating peptide and can reproduce the biological activities of splenin and thymicFormula:C33H55N9O11Purezza:99.16%Colore e forma:SolidPeso molecolare:753.84O-(1H-6-Chlorobenzotriazol-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate
CAS:Formula:C11H15ClF6N5OPPurezza:≥ 99.0%Colore e forma:White to off-white crystalline powderPeso molecolare:413.69
![immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2259.webp&w=3840&q=75)
![type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2188.webp&w=3840&q=75)
![α-1 antitrypsin fragment 235-243 [Homo sapiens]/[Papio hamadryas]/[Cercopithecus aethiops]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2216.webp&w=3840&q=75)
