Peptidi

<p>Catalogue peptide; min. 95% purity</p>

<p>H-Thr-Phe-OH is a fatty acid which is the substrate for tumor cells. It has been shown to be effective against various types of cancer, including metastatic colorectal cancer and malignant brain tumors. H-Thr-Phe-OH binds to tumor cells through fatty acid binding domains on the cell surface, which leads to tumor cell death. This drug also stimulates an increase in the production of natural killer cells, a type of white blood cell that attacks virus infected cells and tumor cells. The activity index for this drug was measured at 3.1 in mice with experimental bowel disease and found to be effective at inhibiting the progression of bowel disease. H-Thr-Phe-OH has also been shown to be effective at treating inflammatory bowel disease in mouse models.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>H-Phe-Val-OH, also known as humanized Val-Phe-His-Leu (VHL), is a monoclonal antibody that binds to the antigen epidermal growth factor (EGF). It has been shown to have diagnostic and therapeutic properties in vitro. This antibody is used in the diagnosis of cancer tissues and is able to identify carcinoma cell lines. Furthermore, it can be used to diagnose hepatitis C virus infection. H-Phe-Val-OH blocks the binding of EGF with its receptor on the surface of cells and prevents the proliferation of cancerous cells. It also inhibits cancer growth by reducing the synthesis of proteins such as epidermal growth factor and transforming growth factor alpha.</p>

<p>Please enquire for more information about (Gly22)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Z-Leu-Tyr-chloromethylketone is a peptide that binds to the reticulum and prevents the release of calcium ions. It is a chloromethyl ketone, which inhibits the L-type calcium channels in cells. Z-Leu-Tyr-chloromethylketone has been shown to block the influx of calcium ions into cytosolic compartments. This process leads to inhibition of protein synthesis and cell death by apoptosis.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Methyltetrazine magnetic beads are uniform polymer-based magnetic spheres of 1 µm diameter. A unique surface means low nonspecific binding in protein-based systems, and superior handling without the use of surfactant. These high-binding beads are suitable for use across a range of research and diagnostic applications, whether you’re working at laboratory scale or have the more stringent requirements of high throughput applications.<br>Activation level: 20-35 nmol methyltetrazine groups per mg<br>Bead diameter: 0.8-1 µmThe magnetic beads are not stable in organic solvents.  Work in aq. solutions at a pH range of 4-9.</p>

<p>Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Big Endothelin-1 (1-39), porcine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Lys(Nde)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Gly-Val-OH is an inhibitor that can be used for the synthesis of peptides. It is a c-terminal amino acid with an optically active, cyclic structure. Z-Gly-Val-OH can be coupled to azide and spheric amino acids, and it undergoes racemization in solvents containing additives. This reagent can also be used for the synthesis of peptides with epimerization or chlorine.</p>

<p>H-Trp-Trp-OH is a reaction product of the amino acid tryptophan and various electron donors. The radical form of H-Trp-Trp-OH has been studied using 2D nuclear magnetic resonance (NMR) spectroscopy to determine its structure. In addition, H-Trp-Trp-OH has been used to study the mechanism of protein phosphorylation reactions. This chemical can be prepared from a solution of tryptophan in water and an oxidizing agent such as hydrogen peroxide or sodium hypochlorite. The frequency shift observed for H-Trp-Trp-OH was attributed to the presence of a constant that was found to be 10 Hz/M, indicating that this substance is a radical form. The sample preparation technique used in this experiment consisted of adding an equal volume of acetic acid to an unknown sample and then centrifuging it at 5000 rpm for five minutes before measuring its fluorescence emission.</p>

<p>Melittin is a peptide that is cationic and polycationic. It has been shown to be effective against mutants, such as those resistant to the antibiotic ampicillin. Melittin also has been shown to have a role in the development of vaccines for Brucella and typhimurium. The peptide has been shown to be effective against type species of these bacteria, such as Salmonella typhimurium and Brucella abortus. The mechanism of action of melittin is not fully understood but it may work by binding to the cell membrane, which causes ion leakage and consequently disrupts cellular functions.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Acetate salt; GLP-1, GIP, and GCGR2 mimic; Obesity research</p>

<p>Please enquire for more information about Fmoc-Leu-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>LL-37 is a potent antimicrobial peptide that has been shown to be effective against cancer cells and is currently being investigated as a potential antineoplastic agent. LL-37 binds to the leukocyte receptor, which leads to chemotaxis, increased expression of p53 and apoptosis. LL-37 also induces apoptotic cell death in epithelial tissues, both in vitro and in vivo. This peptide has been shown to induce death in cancer cells, as well as cell death in other types of cells.</p>

<p>Please enquire for more information about Fmoc-Arg(Pbf)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bpoc-Gly-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Ala-Ser-OH is a basic protein with a sequence of Z-Ala-Ser. It has a hydrophobic section and carboxylic acid group, which is why it is soluble in organic solvents. The dichroic spectra of this protein are characteristic for its secondary structure. This protein can be analyzed using the technique of dichroism, which allows one to determine its analogs as well as analyze its enzyme preparations. The amino acid residues found in this protein are Ala and Ser, which are basic and polar respectively.</p>

<p>13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.</p>

<p>DABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt is a fluorescent substrate for the SARS coronavirus. This compound is an inhibitor of the enzyme that is the target of a drug candidate that inhibits the replication of this virus. Molecular docking studies have shown that DABCYL-Lys-HCoV-SARS Replicase Polyprotein 1ab (3235-3246)-Glu-EDANS trifluoroacetate salt binds to 3clpro, which is part of the active site of the enzyme’s catalytic pocket. Inhibition activity was seen in experiments using recombinant proteins, and kinetic analysis showed this inhibitor has a Ki value of 0.7 mM.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.<br>Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.</p>

<p>Delta-Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu-OH trifluoroacetate salt is a peptide that has been shown to have a hypnotic effect in mice. It was found to increase the time spent on the rotarod and decrease locomotor activity in mice. This drug has also been shown to be hypoglycemic and to modulate transcriptional regulation of fatty acid metabolism. Delta Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly Gly Glu OH trifluoroacetate salt may be useful in treating autoimmune diseases, such as multiple sclerosis, due to its ability to regulate 5HT concentrations.</p>

<p>Bradykinin is a peptide hormone that is produced in the body and has various physiological effects, such as vasodilation, bronchoconstriction, and the release of histamine from mast cells. Bradykinin is also used in pharmacological treatments for malignant brain tumors, congestive heart failure, and epidermal growth factor-responsive dermatoses. Bradykinin can be administered intravenously or subcutaneously to treat these conditions. The drug can also be administered intraperitoneally to treat high blood pressure during pregnancy. Bradykinin is an ester of 3-b-(2-thienyl)-Ala5,Tyr(Me)8-psi(CH2NH)Arg9-OH with trifluoroacetic acid. It is synthesized by linking two molecules together through an ester bond. This drug has many beneficial effects on the human body due to its ability to inhibit enzymes that are involved in the production of prostagland</p>

<p>FITC-Tyr-Val-Ala-Asp-OH (Contains FITC isomer I) is a bioactive molecule that has been shown to inhibit the growth of filamentous fungi. This compound binds to the tyrosine kinase, which is an enzyme involved in the regulation of cell division and differentiation. It also inhibits neutrophil recruitment by dectin-1, a protein that recognizes fungal cell walls on neutrophils. The FITC isomer I has been shown to impair macrophages and fungus aspergillus fumigatus infiltration in tissues with impaired immune function.<br>FITC-Tyr-Val-Ala-Asp-OH (Contains FITC isomer I) has also been shown to decrease the production of caspase 1, which activates inflammatory responses and stimulates phagocytic cells.</p>

<p>a chromogenic substrate for horseshoe crab clotting enzyme, which is used in quantitative assays of endotoxin.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Fmoc-Homoarg (Z)2-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Acetyl-(D-Phe2)-GRF (1-29) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>