Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30060 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
CGRP(83-119), rat
Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor.
Formula:C162H262N50O52S2Purezza:98%Colore e forma:SolidPeso molecolare:3806.3Tos-Gly-Pro-Arg-ANBA-IPA acetate
CAS:Tos-Gly-Pro-Arg-ANBA-IPA (acetate) is a peptide substrate for luminescence measurement.Formula:C32H45N9O10SPurezza:98%Colore e forma:SolidPeso molecolare:747.82WT-1 A1
CAS:WT-1 A1 is an attractive target for immunotherapy in patients with pancreatic adenocarcinoma.Formula:C55H74N10O13SPurezza:98%Colore e forma:SolidPeso molecolare:1115.3Lactoferrin (17-41) TFA (146897-68-9 free base)
Lactoferricin B (amino acids 17-41 of lactoferrin) enhances anti-fungal agents against Candida Albicans.Formula:C143H225F3N46O31S3Purezza:98%Colore e forma:SolidPeso molecolare:3237.79MAGE-A3 (195-203)
CAS:MAGE-3/HLA-A24 is a strong MHC-binding peptide, promising for immunotherapy in MAGE-3+ tumors.Formula:C45H82N10O10SPurezza:98%Colore e forma:SolidPeso molecolare:955.3Trempamotide
CAS:Trempamotide is a bioactive chemical.Formula:C58H80N10O18Purezza:98%Colore e forma:SolidPeso molecolare:1205.31Decabassianolide
CAS:Decabassianolide is a biochemical.Formula:C60H105N5O15Purezza:98%Colore e forma:SolidPeso molecolare:1136.52VV-Hemorphin-7
CAS:VV-Hemorphin-7 is a morphinomimetic peptide.Formula:C59H82N14O13Purezza:98%Colore e forma:SolidPeso molecolare:1195.37GRGDSPC
CAS:GRGDSPC: 7-AA thiolated peptide; non-viral gene vector; easy synthesis; high efficiency; low toxicity.Formula:C25H42N10O11SPurezza:98%Colore e forma:SolidPeso molecolare:690.73Latromotide
CAS:Latromotide is an antineoplastic agent.
Formula:C60H105N17O12Purezza:98%Colore e forma:SolidPeso molecolare:1256.58Leucokinin I acetate
Leucokinin I acetate is an antiserum raised against an insect myotropic peptide.Formula:C43H57N11O14Purezza:98.02%Colore e forma:SolidPeso molecolare:951.98Ac-DEMEEC-OH
CAS:Ac-DEMEEC-OH is a competitive inhibitor of the HCV NS3 protease with a Ki of 0.6 µM.Formula:C29H44N6O16S2Colore e forma:SolidPeso molecolare:796.82HiBiT tag
CAS:The HiBiT tag, a complementary peptide (VSGWRLFKKIS), exhibits high affinity for LgBiT. It is fused with the Gβ subunit of the receptor. The interaction between LgBiT and HiBiT facilitates the stabilization of ETR and G proteins. Additionally, HiBiT can be attached to target proteins (GFP) to quantify their transport to the cytosol.Formula:C63H101N17O14Colore e forma:SolidPeso molecolare:1320.58Enhanced Green Fluorescent Protein (EGFP) (200-208)
CAS:Enhanced Green Fluorescent Protein (200-208) (EGFP (200-208)) is a peptide that strongly binds to H2-K, a restricted cytotoxic T lymphocyte (CTL) epitope.Formula:C45H70N12O15Purezza:98.54% - 99.85%Colore e forma:SolidPeso molecolare:1019.11RO7196472
CAS:RO7196472 is a potent macrocyclic peptide antibiotic that selectively inhibits the activity of Acinetobacter strains. It targets the lipopolysaccharide (LPS) binding site on the inner membrane's LptB2FG complex, inhibiting lipopolysaccharide transport and thereby suppressing the activity of Acinetobacter strains.Formula:C41H49ClN10O3SColore e forma:SolidPeso molecolare:797.41Tyroserleutide TFA (138168-48-6 free base)
Tyroserleutide TFA: a tripeptide from porcine spleen; inhibits tumor growth in vitro/in vivo.Formula:C20H28F3N3O8Purezza:98%Colore e forma:SolidPeso molecolare:495.45Bacterial Sortase Substrate III, Abz/DNP
Sortase A binds virulence proteins to Staphylococcus aureus cell walls, targeting LPXTG motif, cleaves, and catalyzes amide bonds in substrates.
Formula:C41H57N11O14Purezza:98%Colore e forma:SolidPeso molecolare:928Nictide
CAS:Nictide, a peptide substrate for LRRK2 (leucine-rich repeat protein kinase-2), undergoes phosphorylation by the activated form of LRRK2[G2019S], exhibiting a Km value of 10 μM.
Formula:C123H193N45O28Colore e forma:SolidPeso molecolare:2750.13Vm24-toxin
CAS:Vm24-toxin, a peptide toxin isolated from the Mexican scorpion Vaejovis mexicanus smithi, serves as an inhibitor of the Kv1.3 potassium channel [1].Formula:C157H253N51O45S9Purezza:98%Colore e forma:SolidPeso molecolare:3863.59β-Endorphin, equine (TFA)
β-Endorphin, equine (TFA) is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors.Formula:C156H249F3N42O46SPurezza:98%Colore e forma:SolidPeso molecolare:3537.96Abecomotide
CAS:Abecomotide is a bioactive chemical.Formula:C45H79N13O16Purezza:98%Colore e forma:SolidPeso molecolare:1058.19Acth (7-16)NH2
CAS:Acth (7-16)NH2 exhibits neurotrophic effects.Formula:C58H92N18O10Purezza:98%Colore e forma:SolidPeso molecolare:1201.47AMARA peptide TFA (163560-19-8 free base)
AMARA peptide (TFA) is a substrate for salt-induced kinase (SIK) and adenosine activated protein kinase (AMPK).Formula:C64H116F3N27O18SPurezza:98%Colore e forma:SolidPeso molecolare:1640.84ACV 1
CAS:Neuronal nicotinic receptor antagonistFormula:C71H103N23O25S4Purezza:98%Colore e forma:SolidPeso molecolare:1806.98Angiotensin III
CAS:Angiotensin III is an agonist of angiotensin 1 (AT1) and AT2 receptor.Purezza:98%Colore e forma:SolidPeso molecolare:931.11Ac-FEID-CMK TFA
Ac-FEID-CMK TFA is a zebrafish GSDMEb-derived peptide inhibitor that acts by inhibiting the caspy2-mediated atypical inflammatory vesicle pathway.Formula:C29H38ClF3N4O11Purezza:95%Colore e forma:SolidPeso molecolare:711.08Tyr-Somatostatin-14
CAS:Tyr-Somatostatin-14 is a modified peptide incorporating an additional Tyrosine (amino acid) into the structure of Somatostatin-14.Formula:C85H113N19O21S2Purezza:98%Colore e forma:SolidPeso molecolare:1801.05Interphotoreceptor retinoid-binding protein(668-687)
CAS:Interphotoreceptor retinoid-binding protein(668-687)is an amino acid residue of human retinoid-binding protein(IRBP) 668-687, which can induce uveitis.Formula:C91H151N25O32Purezza:98%Colore e forma:SolidPeso molecolare:2107.32QL9
CAS:QL9 is derived from the enzyme 2-oxoglutarate dehydrogenase and belongs to the endogenous peptide repertoire of all H-2d APCs.Formula:C52H74N10O14Purezza:98%Colore e forma:SolidPeso molecolare:1063.21Octapeptide-2
CAS:Octapeptide-2 is a bioactive peptide known for its hair growth-promoting effects and is reported to be used as a cosmetic ingredient [1].Formula:C38H60N10O16SPurezza:98%Colore e forma:SolidPeso molecolare:945.01PKCε inhibitor peptide,myristoylated
Myristoylated PKCε inhibitor peptide (Myr-PKCε-) is a cell-permeable inhibitor consisting of a peptide linked to myristic acid that specifically inhibitsFormula:C51H91N9O14Purezza:98%Colore e forma:SolidPeso molecolare:1054.32Ssm spooky toxin
Ssm Spooky Toxin, derived from Scolopendra mutilans, exhibits potent lethality affecting both hematological and respiratory systems primarily through the
Formula:C270H413N69O79S4Purezza:98%Colore e forma:SolidPeso molecolare:6017.84AHK
CAS:AHK, a bioactive peptide known for its antioxidant properties, has been employed as a cosmetic ingredient [1].Formula:C15H26N6O4Purezza:98%Colore e forma:SolidPeso molecolare:354.4ω-Tbo-IT1
ω-Tbo-IT1, a peptide toxin extracted from the venom of Tibellus oblongus, functions as an inhibitor of insect calcium channels [1].Formula:C171H285N61O53S9Purezza:98%Colore e forma:SolidPeso molecolare:4332.05PKCα (C2-4) inhibitor peptide
PKCα (C2-4) inhibitor peptide is a specific antagonist to PKCα that impedes the α1A-adrenoreceptor agonist A-61603 [1] from inhibiting I_Kr.Formula:C47H74N14O17Purezza:98%Colore e forma:SolidPeso molecolare:1107.17C3a (70-77) TFA (63555-63-5 free base)
C3a (70-77) TFA (Complement 3a (70-77) TFA) is a COOH-terminal fragment of the C3a anaphylatoxin peptide.Formula:C37H62F3N13O12Purezza:98%Colore e forma:SolidPeso molecolare:937.96Jingzhaotoxin XI
Jingzhaotoxin XI (JZTX-XI) is a potent inhibitor of sodium conductance, exhibiting an IC50 value of 124 nM, and notably retards the rapid inactivation of Na_v1.Formula:C158H234N44O47S7Purezza:98%Colore e forma:SolidPeso molecolare:3726.27Catestatin acetate
Catestatin acetate is a non-competitive antagonist of nAChR and inhibits catecholamine release.Formula:C109H177N37O28SPurezza:99.28%Colore e forma:SolidPeso molecolare:2485.87Exendin derivative 1
Exendin derivative 1 is a 39 amino acid peptide.Formula:C184H281N49O61SPurezza:98%Colore e forma:SolidPeso molecolare:4187.56Kemptide
CAS:Kemptide is a synthetic heptapeptide, acting as a substrate for cAMP-dependent protein kinase (PK).Formula:C32H61N13O9Purezza:98%Colore e forma:SolidPeso molecolare:771.91Xenopsin TFA (51827-01-1 free base)
Xenopsin TFA, a neurotensin-like octapeptide from Xenopus skin, inhibits gastric acid secretion.Formula:C49H74F3N13O12Purezza:98%Colore e forma:SolidPeso molecolare:1094.19Leishmania peptide 183
CAS:Leishmania peptide 183 is an antigen.Formula:C44H74N14O18Purezza:98%Colore e forma:SolidPeso molecolare:1087.14Acv tripeptide
CAS:Acv tripeptide is a crucial precursor in penicillin and cephalosporin biosyntheses.Formula:C14H25N3O6SPurezza:98%Colore e forma:SolidPeso molecolare:363.43Bam 12P acetate
Bam 12P acetate is the putative enkephalin precursor in bovine adrenal, pituitary, and hypothalamus.Formula:C64H101N21O18SPurezza:98.84%Colore e forma:SolidPeso molecolare:1484.68[Sar9,Met(O2)11]-Substance P TFA(110880-55-2,free)
Selective NK1 receptor agonist; increases MAP, HR, face washing, sniffing; unique in causing grooming.Formula:C66H101N18F3O17SPurezza:98%Colore e forma:SolidPeso molecolare:1507.68Parathyroid Hormone (1-34), bovine
CAS:Parathyroid Hormone (1-34), bovine is a PTH receptor agonist used to study osteoporosis and hypoparathyroidism.Formula:C183H288N54O50S2Purezza:99.72%Colore e forma:SolidPeso molecolare:4104.39Laminin (925-933)
CAS:Laminin 925-933 is a peptide originating from residues 925-933 of the laminin B1 chain, known for its binding affinity to the laminin receptor.Formula:C40H62N12O14SPurezza:98%Colore e forma:SolidPeso molecolare:967.06δ-Dendrotoxin
CAS:δ-Dendrotoxin is a potassium (K+) channel blocker derived from black mamba snake venom and is utilized in neurological disease research [1].
Formula:C296H452N82O76S6Purezza:98%Colore e forma:SolidPeso molecolare:6567.652: PN: US20040072744 SEQID: 2 claimed protein
CAS:2: PN: US20040072744 SEQID: 2 claimed protein is a synthetic peptide, used for the research of Down' syndrome and schizophrenia.
Formula:C43H67N13O17SPurezza:98%Colore e forma:SolidPeso molecolare:1070.13Somatostatin
CAS:Somatostatin: a peptide hormone inhibiting growth hormone, insulin, and glucagon; secreted by hypothalamus and pancreatic D cells.Purezza:98%Colore e forma:PowderPeso molecolare:1637.88CALP3 TFA(261969-05-5 free base)
CALP3 TFA is a potent Ca2+ channel blocker that activates EF-hand motifs of Ca2+-binding proteins.Formula:C46H69F3N10O11Purezza:98%Colore e forma:SolidPeso molecolare:995.1PKCη pseudosubstrate inhibitor,myristoylated
CAS:Myristoylated PKCη pseudosubstrate inhibitor is a cell-permeable compound utilized to investigate the mechanism of action of PKCη [1].Formula:C101H185N41O23SPurezza:98%Colore e forma:SolidPeso molecolare:2373.88Tamapin TFA
Tamapin TFA, a venom peptide isolated from the Indian red scorpion (Mesobuthus tamulus) [1], selectively targets and blocks small conductance Ca(2+)-activated K
Formula:C146H238N44O41S6·xC2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:3458.11 (free base)Pe1b
Pe1b (μ-TrTx-Pe1b) is a selective inhibitor of the NaV1.7 channel, exhibiting an inhibitory concentration 50 (IC50) value of 167 nanomolar (nM) [1].Formula:C175H237N47O49S6Purezza:98%Colore e forma:SolidPeso molecolare:3975.43κM-Conotoxin RIIIJ
κM-Conotoxin RIIIJ (κM-RIIIJ) selectively inhibits Kv1.2 channels, exhibiting an IC50 value of 33 nM [1].Formula:C117H184N32O36S6Purezza:98%Colore e forma:SolidPeso molecolare:2807.3Jingzhaotoxin-IX
Jingzhaotoxin-IX is a C-terminally amidated peptide neurotoxin consisting of 35 amino acid residues.Formula:C171H251N49O48S6Purezza:98%Colore e forma:SolidPeso molecolare:3953.51IETD-CHO TFA
IETD-CHO TFA (Caspase-8-IN-1) functions as a potent inhibitor of caspase-8 [1].Formula:C95H162N20O26·xC2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:2000.42 (free acid)Hongotoxin-1
Hongotoxin-1, a chemical compound isolated from the venom of Centruroides limbatus, functions as a potassium channel inhibitor.Formula:C181H299N53O49S7Purezza:98%Colore e forma:SolidPeso molecolare:4226.13Tetrapeptide
CAS:Tetrapeptide, an α-MSH analogue, stimulates melanin production and mitigates DNA damage by attenuating reactive oxidative species generation and augmenting DNAFormula:C32H40N10O5Purezza:98%Colore e forma:SolidPeso molecolare:644.72Crotamine
Crotamine, a 42 amino acid toxin featuring three disulfide bridges, functions as a Na+ channel modulator with analgesic properties.Formula:C214H326N64O54S7Purezza:98%Colore e forma:SolidPeso molecolare:4883.73Orexin B, human TFA (205640-91-1 free base)
Orexin B, human (TFA) is an endogenous agonist at Orexin receptor with Kis of 420 and 36 nM for OX1 and OX2.
Formula:C123H212N44O35S·C2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:3013.36Myr-TAT-CBD3
Myr-TAT-CBD3, a CRMP2-CaV2.2 interaction inhibitor, has been shown to significantly attenuate carrageenan-induced thermal hypersensitivity and reverse thermalFormula:C148H269N59O33Purezza:98%Colore e forma:SolidPeso molecolare:3403.09TRV120056 acetate
TRV120056 acetate is a Gq-biased agonist with 10-fold greater molecular efficiency on AT1R-Gq fusion proteins than AT1R-βarr2 fusion proteins.Formula:C45H69N13O14Purezza:99.16%Colore e forma:SolidPeso molecolare:1016.11Ref: TM-T40508L
5mg43,00€10mg63,00€25mg101,00€50mg153,00€100mg221,00€200mg319,00€1mL*10mM (DMSO)85,00€DT-2 acetate
DT-2 acetate, a selective cGMP-dependent protein kinase (PKG) inhibitor, is a mouse monoclonal antibody targeting canine thymocytes.DT-2 acetate inhibits PKG-catalyzed phosphorylation, reverses 8-Br-cGMP-induced expansion, and can be used to study immune disorders.Formula:C124H227N53O25Purezza:99.80%Colore e forma:SolidPeso molecolare:2860.47Sakamototide substrate peptide TFA
Sakamototide substrate peptide TFA is a peptide substrate of AMPK kinase family and can be used for the determination of kinase activity.Formula:C71H123F3N30O25Purezza:98%Colore e forma:SolidPeso molecolare:1853.92MARK Substrate
CAS:MARK Substrate is a MARK substrate peptide.Formula:C60H108N18O21Purezza:98%Colore e forma:SolidPeso molecolare:1417.61Ac-AAVALLPAVLLALLAP-LEVD-CHO
CAS:Ac-AAVALLPAVLLALLAP-LEVD-CHO is a cell-permeable inhibitor of caspase-4 that exhibits antitumor activity [1].Formula:C96H164N20O25Purezza:98%Colore e forma:SolidPeso molecolare:1998.45AtPep3 TFA (902781-14-0 free base)
AtPep3 TFA is a hormone-like peptide that plays a role in the salinity stress tolerance of plants.Formula:C104H179N36F3O34Purezza:98%Colore e forma:SolidPeso molecolare:2534.75Bacterial Sortase Substrate III, Abz/DNP (TFA)
Abz/DNP TFA is a quenched fluorescent peptide, cleaved by SrtA in Staphylococcus aureus, forming amide bonds in cell walls.
Formula:C43H58N11F3O16Purezza:98%Colore e forma:SolidPeso molecolare:1042.02Cenupatide
CAS:Cenupatide: uPAR inhibitor; improves kidney in diabetic rats; inhibits FPR2. No effect on podocyte uPAR levels/activity.Formula:C28H47N11O5Purezza:98%Colore e forma:SolidPeso molecolare:617.756M-2420
CAS:M-2420 is a fluorogenic substrate designed specifically for the β-secretase site found in the Swedish mutation of the amyloid precursor protein (APP).
Formula:C70H91N15O27Purezza:98%Colore e forma:SolidPeso molecolare:1574.56Preprosomatostatin (25-34)
CAS:Preprosomatostatin (25-34) is a peptide.Formula:C52H83N17O15Purezza:98%Colore e forma:SolidPeso molecolare:1186.32Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Purezza:98%Colore e forma:SolidPeso molecolare:3692.15Competence-Stimulating Peptide-12261
CAS:Competence-Stimulating Peptide-12261, a sixteen peptide, is a fragment of competence-stimulating peptide.Formula:C100H149N31O23Purezza:98%Colore e forma:SolidPeso molecolare:2153.45Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell
Blocker of bovine endothelial NOS (599-613), inhibits NO production, useful in managing ischemic injury and inflammation.Formula:C85H127N25O27SPurezza:98%Colore e forma:SolidPeso molecolare:1963.13Magaratensin
CAS:Magaratensin is a neurotensin-related peptide related to the skin of Rana margarate.Formula:C53H83N15O15Purezza:98%Colore e forma:SolidPeso molecolare:1170.32Tanurmotide
CAS:Tanurmotide is a bioactive chemical.Formula:C51H80N14O15SPurezza:98%Colore e forma:SolidPeso molecolare:1161.33Collagen type IV α1 (531-543)
CAS:Human COL4A1 gene on chromosome 13 encodes protein collagen IV α1 (531-543), a ubiquitous subunit important for angiogenesis.Formula:C74H110N18O21Purezza:98%Colore e forma:SolidPeso molecolare:1587.77Renin inhibitory peptide, statine
CAS:Renin inhibitory peptide, statine is a effective, specific statine-containing renin inhibitor.Formula:C54H77N13O9Purezza:98%Colore e forma:SolidPeso molecolare:1052.292Knqdk peptide
CAS:Knqdk peptide is a synthetic pentapeptide, located in residues 112-116 of bovine K-casein.Formula:C25H45N9O10Purezza:98%Colore e forma:SolidPeso molecolare:631.68AF1 Neuropeptide
CAS:AF1 Neuropeptide, known as a sequenced bioactive neuropeptide, was seperated from the nematode Ascaris suum.Formula:C45H69N13O10Purezza:98%Colore e forma:SolidPeso molecolare:952.11Transportan
CAS:Transportan: 27 amino acids with galanin's N-terminus and mastoparan's C-terminus, linked by lysine.Formula:C134H227N35O32Purezza:98%Colore e forma:SolidPeso molecolare:2840.45KTX-Sp2
KTX-Sp2, a potassium channel toxin, effectively blocks exogenous voltage-gated potassium channels Kv1.1, Kv1.2, and Kv1.3, as well inhibits the endogenous Kv1.3Formula:C155H244N58O49S7Purezza:98%Colore e forma:SolidPeso molecolare:3928.41V5 Epitope Tag Peptide Trifluoroacetate
V5 Epitope Tag Peptide Trifluoroacetate is a Tag Peptide derived from a small Epitope on P and V proteins of monkey-virus paramyxovirus.Formula:C64H108N16O20·C2HF3O2Purezza:98%Colore e forma:SolidPeso molecolare:1535.66Ac-IEVDIDVEH (TFA)
Ac-IEVDIDVEH TFA is a short peptide sequence with Ac at the end.Formula:C50H76F3N11O21Purezza:98%Colore e forma:SolidPeso molecolare:1224.19A-71915 TFA (132956-87-7 free base)
A-71915 (TFA) selectively blocks ANP receptor, causing cell death and reduced insulin in RINm5F β-cells.Formula:C71H117F3N26O17S2Purezza:98%Colore e forma:SolidPeso molecolare:1727.986-CR110 Single isomer
CAS:6-CR110 Single isomer is a rhodamine-class green fluorescent dye with ex/em=499/525 nm for DNA or protein labelling and cell staining.Formula:C21H15N2O5ClPurezza:98%Colore e forma:SolidPeso molecolare:410.81C-Type Natriuretic Peptide (1-22) acetate(human)
CNP (1-22), human acetate, NPR-B agonist, inhibits cAMP synthesis, counters histamine and 5-HT effects.Formula:C97H162F3N27O32S3Purezza:95.95%Colore e forma:SolidPeso molecolare:2371.68Calpastatin subdomain B
CAS:Calpastatin subdomain B is a bioactive peptide that inhibits calpain activity.
Formula:C140H227N35O44SPurezza:98%Colore e forma:SolidPeso molecolare:3136.57Z-Pro-Pro-aldehyde-dimethyl acetal
CAS:Z-Pro-Pro-aldehyde-dimethyl acetal is a potent prolyl endopeptidase (PREP) inhibitor, effectively impeding the activity of this cytoplasmic serine endoproteaseFormula:C20H28N2O5Purezza:98%Colore e forma:SolidPeso molecolare:376.45cAC 253
Amylin antagonist AMY3, IC50 0.3 μM, shields neurons from Aβ toxicity, brain-penetrant, boosts memory, lowers Aβ plaques in Alzheimer's mice.
Formula:C126H202N42O40S2Purezza:98%Colore e forma:SolidPeso molecolare:3009.36Ac-AAVALLPAVLLALLAP-LEHD-CHO
CAS:Ac-AAVALLPAVLLALLAP-LEHD-CHO is a caspase inhibitor targeting caspases 4, 5, and 9, demonstrating protective effects in MCF-7 cells treated withFormula:C97H162N22O25Purezza:98%Colore e forma:SolidPeso molecolare:2036.46Oligopeptide-41
Oligopeptide-41 is a bioactive peptide known for its hair growth-promoting effects and is reported to be used as an ingredient in cosmetics [1].
Formula:C63H90N18O19SPurezza:98%Colore e forma:SolidPeso molecolare:1435.56Succinyl-(Pro58,D-Glu65)-Hirudin (56-65) (sulfated)
CAS:Succinyl-(Pro58,D-Glu65)-Hirudin (56-65) (sulfated) is a hirugen-like peptide with greater thrombin affinity than Hirugen, exhibiting a dissociation constant (KFormula:C64H88N10O26SPurezza:98%Colore e forma:SolidPeso molecolare:1445.5Fz7-21 TFA (2247635-23-8 free base)
Fz7-21 TFA is a peptide that blocks FZD7 receptors, with EC50 of 58 nM (human) and 34 nM (mouse).Formula:C85H115N18F3O25S2Purezza:98%Colore e forma:SolidPeso molecolare:1910.07ShK toxin
CAS:ShK toxin, isolated from the Caribbean sea anemone (Stichodactyla helianthus), is an inhibitor of the voltage-dependent potassium channel (Kv1.3 channel).Formula:C169H274N54O48S7Purezza:98%Colore e forma:SolidPeso molecolare:4054.8heparin cofactor II precursor (SERPIND1) fragment [Homo sapiens]
Human Heparin cofactor II fragment, peptide sequence H2N-FTVDRPFLFLIYEHROH, MW=1953.25.Formula:C95H137N23O22Purezza:98%Colore e forma:SolidPeso molecolare:1953.25N-myristoyl-RKRTLRRL
CAS:N-myristoyl-RKRTLRRL is a compound that impedes the binding of protein kinase C (PKC) substrates and inhibits calcium (Ca2+)- and phosphatidylserine (PS)-Formula:C60H117N21O11Purezza:98%Colore e forma:SolidPeso molecolare:1308.71ɛPKC(85-92),Myristoylated
CAS:PKC(85-92)，Myristoylated is a myristic acid-conjugated, cell-permeable peptide activator of PKC that has been shown to increase nitric oxide (NO) release inFormula:C53H80N10O15Purezza:98%Colore e forma:SolidPeso molecolare:1097.26Ac-ESMD-CHO
CAS:Ac-ESMD-CHO functions as an inhibitor of both caspase-3 and caspase-7, specifically obstructing the proteolytic cleavage of the caspase-3 precursor peptide (
Formula:C19H30N4O10SPurezza:98%Colore e forma:SolidPeso molecolare:506.53
![heparin cofactor II precursor (SERPIND1) fragment [Homo sapiens]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2256.webp&w=3840&q=75)
