Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30473 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Acetalin 3, Opioid Receptor Antagonist 3
<p>Catalogue peptide; min. 95% purity</p>Formula:C42H61N114O8S2Peso molecolare:912.15 g/molHuman CMV Assemblin Protease Substrate (M-site)
<p>Catalogue peptide; min. 95% purity</p>Formula:C52H96N20O16Peso molecolare:1,257.47 g/mol2A/2B Dengue Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C39H68N16O11Peso molecolare:937.08 g/molGIP, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C226H343N61O66SPeso molecolare:5,002.69 g/molP75-TNFR Fragment
<p>Catalogue peptide; min. 95% purity</p>Formula:C53H85N15O15SPeso molecolare:1,204.42 g/molEp-CAM (263-271)
<p>Catalogue peptide; min. 95% purity</p>Formula:C38H70N10O10Peso molecolare:827.04 g/molSomatostatin-14 (2-9)
<p>Catalogue peptide; min. 95% purity</p>Formula:C50H67N12O10SPeso molecolare:1,028.23 g/mol[Asn76] PTH (64-84), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C94H163N27O35Peso molecolare:2,231.51 g/mol[D-Arg1,D-Pro2,D-Phe7,D-His9]-Substance P
<p>Catalogue peptide; min. 95% purity</p>Formula:C67H102N20O13SPeso molecolare:1,427.75 g/molβ-Amyloid (15-21)
<p>Catalogue peptide; min. 95% purity</p>Formula:C43H65N9O9Peso molecolare:852.05 g/molH-Ile-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Ile-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purezza:Min. 95%Acyl Carrier Protein (65-74) (acid)
<p>Catalogue peptide; min. 95% purity</p>Formula:C47H74N12O16Peso molecolare:1,063.18 g/molβ-Amyloid (1-33)
<p>Catalogue peptide; min. 95% purity</p>Formula:C164H242N46O51Peso molecolare:3,673.94 g/molLamprey PQRFamide
<p>Catalogue peptide; min. 95% purity</p>Formula:C102H147N29O22S2Peso molecolare:2,195.62 g/mol[Val3]-β-Casomorphin (1-4) amide (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formula:C24H35N5O5Peso molecolare:473.58 g/molBone Matrix Proteins
<p>Catalogue peptide; min. 95% purity</p>Formula:C40H67N13O14Peso molecolare:954.06 g/molCathepsin S substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C41H66N12O9Peso molecolare:871.08 g/molMMP-2/MMP-9 Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formula:C44H61N13O13SPeso molecolare:1,012.1 g/mol[Ile76]-TNF-a (70-80) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C55H91N15O16Peso molecolare:1,218.43 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat)
<p>Catalogue peptide; min. 95% purity</p>Formula:C61H110N24O14Peso molecolare:1,403.71 g/mol[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) ((Ala286)-CaMK-II (281-302))
<p>Catalogue peptide; min. 95% purity</p>Formula:C111H191N39O29S2Peso molecolare:2,600.07 g/molHPV-E6-C
<p>Catalogue peptide; min. 95% purity</p>Formula:C110H178N36O30SPeso molecolare:2,516.92 g/molGRF (free acid) (human)
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H357N71O67SPeso molecolare:5,040.74 g/molAmyloid β-Protein (33-42)
<p>Catalogue peptide; min. 95% purity</p>Formula:C41H74N10O11SPeso molecolare:915.17 g/mol[Tyr63] PTH (63-84), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C103H172N28O37Peso molecolare:2,394.68 g/molDok-4 (130-145)
<p>Catalogue peptide; min. 95% purity</p>Formula:C83H128N22O25SPeso molecolare:1,866.1 g/molCasein Kinase II Receptor Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C52H87N19O24Peso molecolare:1,362.3 g/molGnT-V (nt38-67)
<p>Catalogue peptide; min. 95% purity</p>Formula:C54H89N13O13SPeso molecolare:1,159.45 g/molPannexin-1 Fragment (4515)
<p>Catalogue peptide; min. 95% purity</p>Formula:C59H104N22O20Peso molecolare:1,441.62 g/mol[D-Pro194]-IL-1 β (193-195) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C15H28N4O5Peso molecolare:344.41 g/molLeucokinin III
<p>Catalogue peptide; min. 95% purity</p>Formula:C40H52N12O13Peso molecolare:908.9 g/molInsulin-Like Growth Factor II (69-84)
<p>Catalogue peptide; min. 95% purity</p>Formula:C83H124N20O26Peso molecolare:1,817.9 g/molAc-d-Endorphin (bovine, camel, mouse, ovine)
<p>Catalogue peptide; min. 95% purity</p>Formula:C138H217N35O40SPeso molecolare:3,038.54 g/molα-Substance IB
<p>Catalogue peptide; min. 95% purity</p>Formula:C33H51N9O7Peso molecolare:685.82 g/molIntermedin (rat)
<p>Catalogue peptide; min. 95% purity</p>Formula:C226H361N75O64S2Peso molecolare:5,216.99 g/molHepatitis B Virus Receptor Binding Fragment
<p>Catalogue peptide; min. 95% purity</p>Formula:C140H185N35O42Peso molecolare:3,030.17 g/molNon-Ab Component of Alzheimer's Disease Amyloid
<p>Catalogue peptide; min. 95% purity</p>Formula:C141H235N39O49Peso molecolare:3,260.68 g/mol[Pro34]-Neuropeptide Y, human, rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C189H285N55O57SPeso molecolare:4,271.67 g/molBDC 2.5(A)
<p>Catalogue peptide; min. 95% purity</p>Formula:C60H99N19O14SPeso molecolare:1,342.64 g/molAc-Neurotrophin Receptor (368-381) amide (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C69H124N22O19Peso molecolare:1,565.89 g/molβ-Endorphin (1-5), (16-31), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C112H173N27O29SPeso molecolare:2,393.86 g/molHistone H3 (116-136), N15-39
<p>Catalogue peptide; min. 95% purity</p>Formula:C112H197N39O30Peso molecolare:2,570 g/molSMCY (950-960) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C49H85N15O18Peso molecolare:1,172.31 g/molMelanin Concentrating Hormone, human, mouse, rat MCH, human, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C105H160N30O26S4Peso molecolare:2,386.83 g/molH-D-Ile-OBzl·p-tosylate
CAS:<p>H-D-Ile-OBzl·p-tosylate is a synthetic compound that has been found to have an excitatory effect on the bitter taste receptor. The leaves of plants are mutant and agglutination tests for this compound show that it is a hexapeptide. H-D-Ile-OBzl·p-tosylate can be synthesized from erythritol and p-toluenesulfonyl chloride. The chemical data for this compound indicates that it has a molecular weight of 442.3 Da and the observed spectra indicate that it is a white solid with no charge.</p>Formula:C13H19NO2·C7H8O3SPurezza:Min. 95%Peso molecolare:393.5 g/mol[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)
<p>Catalogue peptide; min. 95% purity</p>Formula:C54H79N13O17Peso molecolare:1,182.31 g/molBiotin-Gastrin Releasing Peptide, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C140H218N40O33S3Peso molecolare:3,085.74 g/molCripto-1, CR-1
<p>Catalogue peptide; min. 95% purity</p>Formula:C86H129N27O27S2Peso molecolare:2,037.26 g/mol[Sar1]-Angiotensin I/II (1-7) amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C40H63N13O8Peso molecolare:854.02 g/molPlatelet Membrane Glycoprotein IIB Peptide (296-306)
<p>Catalogue peptide; min. 95% purity</p>Formula:C47H75N17O20Peso molecolare:1,198.22 g/molAc-D-Lys-OH
CAS:<p>Nicotinamide is a form of vitamin B3 that has been shown to inhibit the growth of Giardia lamblia trophozoites. Nicotinamide also inhibits the sirtuins and has been shown to inhibit cell cycle control in microorganisms. It inhibits transcriptional activity by competing with nicotinamide adenine dinucleotide for binding sites on DNA and prevents the formation of nicotinamide-adenine dinucleotide complexes, which are needed for DNA synthesis. Nicotinamide also binds to metronidazole, causing it to be inactive as an antimicrobial agent. The mechanism of action of nicotinamide may be due to its ability to bind and inactivate metronidazole, thereby preventing it from functioning as an anti-microbial agent.</p>Formula:C8H16N2O3Purezza:Min. 95%Peso molecolare:188.22 g/molLeucokinin VII
<p>Catalogue peptide; min. 95% purity</p>Formula:C40H52N10O12Peso molecolare:864.9 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ser-Lys-Lys-Lys-Lys-OH trifluoroacetate salt
CAS:<p>Agonist of toll-like receptors TLR1/2</p>Formula:C81H156N10O13SPurezza:Min. 95%Peso molecolare:1,510.23 g/molTransglutaminase Substrate, biotinylated
<p>Catalogue peptide; min. 95% purity</p>Formula:C40H66N10O14SPeso molecolare:943.10 g/mol[Tyr11]-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Formula:C76H104N18O20S2Peso molecolare:1,653.91 g/molp5 Ligand for Dnak and and DnaJ
<p>Catalogue peptide; min. 95% purity</p>Formula:C44H81N15O11SPeso molecolare:1,028.29 g/molAc-Amyloid β-Protein (15-20) amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C42H63N9O8Peso molecolare:822.03 g/molFmoc-Glu(OtBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purezza:Min. 95%Biotin-[Tyr0]-Orexin B, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C145H238N48O38S2Peso molecolare:3,325.86 g/molKetolide resistance Peptide MRFFV
<p>Catalogue peptide; min. 95% purity</p>Formula:C34H50N8O6SPeso molecolare:698.9 g/molα-Melanocyte Stimulating Hormone (11-13)(MSHa)
<p>Catalogue peptide; min. 95% purity</p>Formula:C16H31N5O3Peso molecolare:341.46 g/molFmoc-Thr(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Thr(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purezza:Min. 95%(Ile76)-TNF-a (70-80) (human)
CAS:<p>Please enquire for more information about (Ile76)-TNF-a (70-80) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H91N15O16Purezza:Min. 95%Peso molecolare:1,218.4 g/mol[D-Ala2] Deltorphin I
<p>Catalogue peptide; min. 95% purity</p>Formula:C37H52N8O10Peso molecolare:768.87 g/molβ-Endorphin (30-31) (human)
CAS:<p>Beta-Endorphin (30-31) is a protein that binds to the carotid. It has been shown to promote the growth of bacteria in culture, and is thought to be involved in the regulation of bacterial DNA replication. Beta-Endorphin (30-31) has a molecular weight of approximately 3,000 Daltons and contains two hydroxyl groups. This protein may also be involved in protein synthesis and hydrogen bonding with other proteins.</p>Formula:C7H12N2O5Purezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:204.18 g/molAbz-Amyloid β/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt
CAS:<p>Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C43H62N12O15SPurezza:Min. 95%Peso molecolare:1,019.09 g/molPrepro TRH (53-74)
<p>Catalogue peptide; min. 95% purity</p>Formula:C118H182N32O32Peso molecolare:2,560.96 g/molFmoc-Leu-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Leu-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purezza:Min. 95%H-Cys(Bzl)-Gly-OH trifluoroacetic acid
CAS:<p>Please enquire for more information about H-Cys(Bzl)-Gly-OH trifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16N2O3S•(CF3CO2H)xPurezza:Min. 95%Peso molecolare:268.33 g/molBid BH3
<p>Catalogue peptide; min. 95% purity</p>Formula:C74H127N29O24SPeso molecolare:1,839.08 g/molSomatostatin Tumor Inhibiting Analog
<p>Catalogue peptide; min. 95% purity</p>Formula:C54H70N11O10S2Peso molecolare:1,097.4 g/mol[Pyr11]-Amyloid β-Protein (11-40)
<p>Catalogue peptide; min. 95% purity</p>Formula:C143H226N38O39SPeso molecolare:3,133.71 g/mol[β-Ala8]-Neurokinin A (4-10)
<p>Catalogue peptide; min. 95% purity</p>Formula:C35H56N8O10SPeso molecolare:781 g/mol[Pyr3]-Amyloid β-Protein (3-42)
<p>Catalogue peptide; min. 95% purity</p>Formula:C196H299N53O55SPeso molecolare:4,309.97 g/molgp120, HIV-1 MN
<p>Catalogue peptide; min. 95% purity</p>Formula:C135H221N45O33Peso molecolare:3,002.55 g/molBiotin-Phosphorylated MBP (94-102)
<p>Catalogue peptide; min. 95% purity</p>Formula:C49H85N20O15SPeso molecolare:1,273.41 g/molNeurogranin (28-43)
<p>Catalogue peptide; min. 95% purity</p>Formula:C78H134N28O19SPeso molecolare:1,800.18 g/molProtein Kinase C Substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C51H100N22O11Peso molecolare:1,197.5 g/molC-Myc peptide epitope
<p>Catalogue peptide; min. 95% purity</p>Formula:C51H86N12O21Peso molecolare:1,203.32 g/molAdrenomedullin (1-12), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C64H100N22O19SPeso molecolare:1,513.7 g/mol[D-Pro2]-β-Casomorphin (1-5) , bovine, amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C30H38N6O6Peso molecolare:578.7 g/molLHRH-Ⅲ, lamprey
<p>Catalogue peptide; min. 95% purity</p>Formula:C59H75N18O14Peso molecolare:1,259.4 g/molCC Chemokine Receptor 3 Fragment II
<p>Catalogue peptide; min. 95% purity</p>Formula:C114H174N24O43S2Peso molecolare:2,632.91 g/molEndothelin-1 (1-15), amide, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C70H109N17O23S5Peso molecolare:1,717.04 g/molLeptin (138-167) (human)
CAS:<p>Please enquire for more information about Leptin (138-167) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C141H224N37O47S2Purezza:Min. 95%Peso molecolare:3,253.64 g/mol[D-Trp8,D-Cys14]-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Formula:C76H104N18O19S2Peso molecolare:1,637.91 g/molγ-2-MSH (41-58), amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C74H100N22O15SPeso molecolare:1,569.82 g/mol[Tyr1]-pTH (1-34) (rat)
<p>Catalogue peptide; min. 95% purity</p>Formula:C186H295N55O49S2Peso molecolare:4,149.86 g/molCC Chemokine Receptor 3 Fragment II, amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C114H175N25O42S2Peso molecolare:2,631.93 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H62N11O13PPurezza:Min. 95%Peso molecolare:1,092.1 g/mol[Nle21,Tyr32] Corticotropin Releasing Factor, ovine
<p>Catalogue peptide; min. 95% purity</p>Formula:C209H343N57O64Peso molecolare:4,678.29 g/molDynorphin A (9-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C53H85N17O14Peso molecolare:1,184.37 g/molβ-Amyloid (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formula:C56H76N16O22Peso molecolare:1,325.32 g/molLys-(Tyr8)-Bradykinin
<p>Catalogue peptide; min. 95% purity</p>Formula:C56H85N17O13Peso molecolare:1,204.41 g/mol
![[Asn76] PTH (64-84), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00372.webp&w=3840&q=75)
![[D-Arg1,D-Pro2,D-Phe7,D-His9]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00149.webp&w=3840&q=75)
![[Val3]-β-Casomorphin (1-4) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00914.webp&w=3840&q=75)
![[Ile76]-TNF-a (70-80) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00637.webp&w=3840&q=75)
![[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) ((Ala286)-CaMK-II (281-302))](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00600.webp&w=3840&q=75)
![[Tyr63] PTH (63-84), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00861.webp&w=3840&q=75)
![[D-Pro194]-IL-1 β (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[Pro34]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00912.webp&w=3840&q=75)
![[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00929.webp&w=3840&q=75)
![[Sar1]-Angiotensin I/II (1-7) amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00205.webp&w=3840&q=75)
![[Tyr11]-Somatostatin-14](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00219.webp&w=3840&q=75)
![Biotin-[Tyr0]-Orexin B, mouse, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00130.webp&w=3840&q=75)
![[D-Ala2] Deltorphin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00825.webp&w=3840&q=75)
![[Pyr11]-Amyloid β-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[β-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00348.webp&w=3840&q=75)
![[Pyr3]-Amyloid β-Protein (3-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00174.webp&w=3840&q=75)
![[D-Pro2]-β-Casomorphin (1-5) , bovine, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00842.webp&w=3840&q=75)
![[D-Trp8,D-Cys14]-Somatostatin-14](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00216.webp&w=3840&q=75)
![[Tyr1]-pTH (1-34) (rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00930.webp&w=3840&q=75)
![[Nle21,Tyr32] Corticotropin Releasing Factor, ovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00739.webp&w=3840&q=75)
