Peptidi

<p>Please enquire for more information about Fmoc-Tyr(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-Ala-Ala-OH is a synthetic peptide that has been shown to inhibit protease activity and is being investigated as a potential treatment for chronic arthritis. This peptide has been shown to be effective in the removal of nitrogen from wastewater. The conformational properties of H-Ala-Ala-Ala-OH are similar to those of the human serum amide, which is thought to have an antiarthritic effect and may also act as a model system for other peptides. H-Ala-Ala-Ala-OH has also been shown to have enzyme activities, including dihedral and structural analysis.</p>

<p>Please enquire for more information about Trt-Glu(OtBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about FITC-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-OH (Contains FITC isomer I) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-N-Me-D-Tyr-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Boc-beta-cyclopropyl-Ala-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cys(Bzl)-Gly-OH trifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-D-Homoarg (Et)2-OH (symmetrical) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Z-Leu-Leu-Arg-AMC is a proteolytic substrate that is used to study the activation of Th17 cells. It activates these cells by binding to the antigen peptide and protease activity, which are involved in the immune response. Z-Leu-Leu-Arg-AMC has been shown to induce autoimmune diseases in mice, as well as other conditions such as chronic inflammation and obesity. This compound also has a potential drug target for neutralizing acidity, which could be useful in treating cancer and other diseases. Z-Leu-Leu-Arg-AMC is stable at acidic pHs and can be used for biochemical studies of proteases at acidic pHs.</p>

<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Asp(OMe)-Val-Ala-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Lys(Z)2)-Tuftsin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Thr-Phe-OH is a fatty acid which is the substrate for tumor cells. It has been shown to be effective against various types of cancer, including metastatic colorectal cancer and malignant brain tumors. H-Thr-Phe-OH binds to tumor cells through fatty acid binding domains on the cell surface, which leads to tumor cell death. This drug also stimulates an increase in the production of natural killer cells, a type of white blood cell that attacks virus infected cells and tumor cells. The activity index for this drug was measured at 3.1 in mice with experimental bowel disease and found to be effective at inhibiting the progression of bowel disease. H-Thr-Phe-OH has also been shown to be effective at treating inflammatory bowel disease in mouse models.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>H-Phe-Val-OH, also known as humanized Val-Phe-His-Leu (VHL), is a monoclonal antibody that binds to the antigen epidermal growth factor (EGF). It has been shown to have diagnostic and therapeutic properties in vitro. This antibody is used in the diagnosis of cancer tissues and is able to identify carcinoma cell lines. Furthermore, it can be used to diagnose hepatitis C virus infection. H-Phe-Val-OH blocks the binding of EGF with its receptor on the surface of cells and prevents the proliferation of cancerous cells. It also inhibits cancer growth by reducing the synthesis of proteins such as epidermal growth factor and transforming growth factor alpha.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Glutaryl-Phe-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Lysyllysine dihydrochloride: enzyme-cleavable linker for delivering bioactive peptides.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Fmoc-Leu-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Imidazo[1,2-a]pyridin-7-amine hydrobromide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ile-Ser-OH trifluoroacetic acid is a bioactive compound that has been cocrystallized with N,N′-dimethylformamide and analyzed using liquid chromatography/mass spectrometry. It has been shown to be hydrophilic and soluble in water. H-Ile-Ser-OH trifluoroacetic acid has also been detected by mass spectrometric methods as well as electrospray mass spectrometry.</p>

<p>Please enquire for more information about Z-D-Arg-Gly-Arg-pNA dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about H-D-Ile-Phe-Lys-pNA trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Key subunit of extracellular plaques found in the brains of patients with Alzheimer's disease; Hydrochloride salt</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Fmoc-Gly-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Melittin is a peptide that is cationic and polycationic. It has been shown to be effective against mutants, such as those resistant to the antibiotic ampicillin. Melittin also has been shown to have a role in the development of vaccines for Brucella and typhimurium. The peptide has been shown to be effective against type species of these bacteria, such as Salmonella typhimurium and Brucella abortus. The mechanism of action of melittin is not fully understood but it may work by binding to the cell membrane, which causes ion leakage and consequently disrupts cellular functions.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Hippuryl-His-Leu-OH is a peptide that inhibits the activity of angiotensin converting enzyme (ACE) at a concentration of 50 μM. It has been shown to inhibit cyclase and other enzymes in vitro. The binding of this compound to ACE prevents the conversion of angiotensin I to angiotensin II, which is a potent vasoconstrictor. Hippuryl-His-Leu-OH also has inhibitory properties against atrial natriuretic peptide (ANP), and can be used as an antihypertensive agent. This drug has been shown to have growth factor β1 activities, and can be used for the treatment of cardiac diseases such as myocardial infarction. Structural analysis shows that this drug binds to the active site of ACE, inhibiting its activity by blocking access to substrate or by altering substrate specificity.</p>

<p>Nle-Leu-Phe-OH is a potent colony-stimulating factor that binds to the receptor on the surface of cells and stimulates the production of white blood cells. Nle-Leu-Phe-OH has been shown to induce actin filament formation, which is necessary for cell movement. It also induces cytosolic calcium release and enhances protein synthesis. Nle-Leu-Phe-OH also binds to phosphatase and inhibits its activity, which may be due to a conformational change in the enzyme. This process is necessary for the synthesis of DNA and other proteins from amino acids. Nle-Leu-Phe-OH also causes an increase in the uptake of Ca2+ ions by cells.</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Rec FGF basic (human) is a human recombinant growth factor that has been shown to be effective in the treatment of life-threatening conditions. Rec FGF basic (human) stimulates the proliferation of various tissue cells, including butyric acid, which are found in abdominal and intestinal tissues. Rec FGF basic (human) also promotes the synthesis of collagen, a protein that is important for healthy skin and vascular walls. Rec FGF basic (human) has been shown to inhibit platelet-derived growth factor and estradiol production, which may be beneficial in the treatment of breast cancer. Rec FGF basic (human) has also been shown to stimulate tissue plasminogen activator production, which prevents blood clot formation and helps dissolve blood clots that have already formed.</p>

<p>TFA salt. Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about Isocyanomethyl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TFA salt. Tripeptide containing hydroxyproline.</p>

<p>Please enquire for more information about Fmoc-Ile-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-His-Phe-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-Phe-Pro-OH is a sensor molecule that has been used in supramolecular, nanostructured, and biological applications. It is a supramolecular self-assembly process that can be applied to sensors, devices, and modules. Fmoc-Phe-Pro-OH can be used as a biological source for sensing bacteria or other molecules of interest. The structural properties of Fmoc-Phe-Pro-OH have been studied extensively and it has been found to have favorable properties for use in humans. Advances in this field are ongoing with the hope of improving the understanding of biological systems and human health.</p>

<p>Please enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Please enquire for more information about H-D-Asp(OtBu)-allyl ester·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>