CymitQuimica logo
Peptidi

Peptidi

I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.

Sottocategorie di "Peptidi"

Trovati 29874 prodotti di "Peptidi"

Ordinare per

Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
prodotti per pagina.
  • Fmoc-Ser(tBu)-Wang Resin (100-200 mesh) 1% DVB


    Wang resin is a high purity, ion-exchange resin that is used in the preparation of peptides and proteins. The resin contains a cationic quaternary ammonium group that can be used to bind anionic molecules such as phosphates, sulfates, phosphonates, and carboxylates. Wang resin is also capable of binding to the amino groups on proteins. This resin has been shown to have excellent receptor binding capacity for peptides and proteins. In addition, Wang resin has been shown to be an activator of G-protein coupled receptors and ion channels. Wang resin has been used in research for life science and cell biology applications including antibody production and inhibitor studies.
    Purezza:Min. 95%

    Ref: 3D-RFS-1333-PI

    1g
    136,00€
    5g
    372,00€
  • H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2


    Peptide H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49768

    ne
    Prezzo su richiesta
  • Ac-KKARFSRFAGSSPSQSSMVAR-NH2


    Peptide Ac-KKARFSRFAGSSPSQSSMVAR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49853

    ne
    Prezzo su richiesta
  • GP120 - W61D - 57


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecolare:1,621.9 g/mol

    Ref: 3D-PP50244

    ne
    Prezzo su richiesta
  • H-VVLAYEPVWAIGTGK^-OH


    Peptide H-VVLAYEPVWAIGTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45996

    ne
    Prezzo su richiesta
  • H-NTTCVNWNQY-NH2


    Peptide H-NTTCVNWNQY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP44624

    ne
    Prezzo su richiesta
  • H-MDILSYMR^-OH


    Peptide H-MDILSYMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP41895

    ne
    Prezzo su richiesta
  • H-SIPQVSPVR^-OH


    Peptide H-SIPQVSPVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40149

    ne
    Prezzo su richiesta
  • Biotin-Desmoglein-3 DSG3 (50-79)


    Desmoglein-3 DSG3 (50-79) is derived from the pemphigus vulgaris antigen DSG3 and is involved in cell-cell adhesion. It can exist as non-junctional and junctional and is one of the desmosomal cadherins. Within the epithelial cells non-junctional DSG3 takes part in E-cadherin signalling.The overexpression of DSG3 has been observed in squamous cell carcinoma and can be used as a biomarker for cervical sentinel lymph nodes. DSG3 in tumours is considered as being pro-metastatic through DSG3 ability to activate AP-1 and the PKC/Ezrin pathway.Biotin (B7) has been added to the N-terminus.
    Colore e forma:Powder
    Peso molecolare:3,705.9 g/mol

    Ref: 3D-CRB1000386

    1mg
    282,00€
    500µg
    206,00€
  • Kisspeptin 14 human


    The biologically active C-terminal region of Kisspeptin. Kisspeptin, is cleaved from a 145 amino acid precursor to a 54 amino acid peptide in humans and a 52 amino acid peptide in mice. Smaller isoforms of 14, 13 and 10 amino acids have also been isolated in humans, each sharing the common C-terminal sequence. Kisspeptin-14 (KP-14) has equivalent receptor binding efficiency and potency to full length Kisspeptin.Kisspeptin, a product of the KISS1 gene, is a hypothalamic neuropeptide that stimulates gonadotropin-releasing hormone (GNRH) neurons and drives fertility. When energy balance is severely altered (either negatively or positively), Kiss1 expression and fertility are compromised. Kisspeptin neurons are responsible for the transmission of key homeostatic information to GNRH neurons, which is likely to mediate the link between energy balance and fertility. Leptin, ghrelin, pro-opiomelanocortin (POMC), and neuropeptide Y (NPY) have been suggested as modulators of this process.Kisspeptin binds specifically to the G-protein-coupled receptor-54, now known as Kiss1r, which is expressed in almost all GNRH neurons. Kisspeptin plays an essential role in reproduction, and Kiss1r mutations have been isolated in cases of defects in sexual development. Kiss1r is also expressed in other areas of the brain and periphery, highlighting other possible roles for kisspeptin outside of reproduction. Due to kisspeptins importance in reproduction it is synthesized in excess to ensure reproductive success.
    Colore e forma:Powder
    Peso molecolare:1,740.8 g/mol

    Ref: 3D-CRB1000930

    1mg
    282,00€
    500µg
    206,00€
  • Tregitope 289


    T regulatory cell epitopes (Tregitopes) are a set of natural T cell epitopes derived from immunoglobulin G. These peptides are Treg-activating and show some promise in prophylactic and therapeutic studies in type 1 diabetes mellitus: which is associated with effector T cell (Teff) destruction of insulin-producing pancreatic β-islet cells. In non-diabetics, self-reactive T cells are deleted during thymic development, rendered anergic, or converted into natural regulatory T cells (Tregs) that suppress autoimmune responses.Tregitopes are processed and presented by MHC class II molecules. They can suppress effector T cell responses, and up-regulate Treg-associated cytokines and chemokines. Tregitopes help stimulate 'antigen-specific adaptive tolerance induction' (ASATI) to modulate antigen-specific transplant rejection and to reduce immune responses to allergens in vitro and in vivo.
    Peso molecolare:2,564.3 g/mol

    Ref: 3D-CRB1000952

    1mg
    282,00€
    500µg
    206,00€
  • Ovalbumin (324-338), chicken, quail


    Ovalbumin (OVA) is the primary protein in egg-white, and is involved in initiating food allergies and asthma. It is a highly immunogenic protein and can be used for peptide conjugation in the development of antibodies.OVA (324-338) is a class I (Kb)-restricted peptide epitope of OVA. The ovalbumin fragment is presented by the class I MHC molecule, H-2Kb.

    Peso molecolare:1,559.8 g/mol

    Ref: 3D-CRB1001228

    1mg
    282,00€
    500µg
    206,00€
  • H-TGISPLALI^K-OH


    Peptide H-TGISPLALI^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46012

    ne
    Prezzo su richiesta
  • EBV BNRF1 (1238-1252)


    Cellular immunotherapy is an effective treatment option against Epstein-Barr virus (EBV)-driven lymphoproliferation in recipients of hematopoietic stem cells. However, increasing the number of identified epitope targets will help improve the response rate and success. Viral tegument protein BNRF1 is a critical target in EBV inducing specific CD4+ T-cell responses. 18 epitopes within BNRF1 are known, including  (1238-1252). BNRF1-specific CD4+ T cells are cytotoxic and limit EBV-driven B cell transformation. Work with EBV BNRF1 (1238-1252) epitope and others will help improve T cell immunotherapy and our understanding of host-virus interaction.

    Peso molecolare:1,838.9 g/mol

    Ref: 3D-CRB1001669

    1mg
    282,00€
    500µg
    206,00€
  • Fz7-21


    Binds to the cysteine rich domain of the Frizzled 7 receptor and inhibits Wnt signalling in cultured cells and stem cell function in intestinal organoids.

    Colore e forma:Powder
    Peso molecolare:1,794.8 g/mol

    Ref: 3D-CRB1001175

    1mg
    282,00€
    500µg
    206,00€
  • Melittin [Cy5]


    Melittin is a 26-residue cationic, haemolytic peptide isolated from honeybee venom. Melittin lowers the surface tension at the plasma membrane and causes cell lysis. It also exhibits potent anti-inflammatory and antimicrobial activity. Melittin has been extensively used as a model peptide for observing membrane lipid-protein interaction. In Melittin [Cy5] the fluorophore Cy5, a member of the Cy-Dye fluorescent molecule group which are most commonly used in DNA-related applications is added to the melittin peptide.
    Colore e forma:Powder
    Peso molecolare:3,712 g/mol

    Ref: 3D-CRB1130465

    1mg
    727,00€
    5mg
    2.106,00€
    100µg
    386,00€
    500µg
    470,00€
  • Histone H3 (32-38) K36Me2


    Histone H3 (32-38) K36Me2 is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter to change the positioning of the nucleosome, allowing the DNA it to be either available to the transcription machinery or inaccessible.The Histone H3 (32-38) lysine 36 has been dimethylated.

    Peso molecolare:713.4 g/mol

    Ref: 3D-CRB1001551

    1mg
    386,00€
    500µg
    282,00€
  • Phosphorylated Sakamototide


    Sakamototide is phosphorylated by members of the 5'-adenosine monophosphate-activated protein kinase (AMPK) family of kinases as is therefore ideal for use in kinase assays to test the activity of AMPK family members. The AMPK family includes- salt inducible kinases (SIKs), NUAK, sucrose non-fermenting (Snf1)-related kinase (SNRK), microtubule affinity regulating kinases (MARKs) and brain specific kinase/BR serine/threonine kinase (BRSK). The kinase activity of AMPK and AMPK-related kinases, is dependent on its phosphorylation at Thr175 by the upstream kinase LKB1 (also known as STK11).
    Colore e forma:Powder
    Peso molecolare:1,818.9 g/mol

    Ref: 3D-CRB1000979

    1mg
    386,00€
    5mg
    891,00€
    500µg
    282,00€
  • beta-Amyloid (1-11) Biotin


    β-Amyloid 1-11 (Aβ1-11) is one of many short Aβ species found in vivo and is formed by the cleavage of amyloid β precursor protein by β- and α-secretase. Amyloid β-protein (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer disease (AD) and Down syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then &γ--secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.Biotin is C-terminally linked to the peptide via ethylenediaminefor convenient detection and purification. Alternative β-Amyloid fragments and labels are also available, please refer to our peptide catalogue for availability.
    Peso molecolare:1,592.7 g/mol

    Ref: 3D-CRB1001449

    1mg
    282,00€
    500µg
    206,00€
  • Acetyl-Adhesin trifluoroacetate


    Bacterial cell invasion begins by initially adhering to mucosa of the oro-intestinal, nasorespiratory, or genitourinary tract by specific adhesins. This leads to colonization of the region and ultimately infection. Studies showed acetyl-adhesin can inhibit binding of S. mutans to salivary receptors and can prevent S. mutans colonising the teeth. This suggests the peptide may be a useful antimicrobial agent against bacterial mucosal colonisation, particularly tooth decay.

    Peso molecolare:2,202.46 g/mol

    Ref: 3D-CRB1000026

    1mg
    282,00€
    500µg
    206,00€
  • AIP-II


    Auto-inducing peptide (AIP) is a cyclic thiolactone quorum sensing peptide from Staphylococcus aureus which is responsible for activating the agr response. AIP is released from the bacteria and its extracellular concentration is then sensed by a two-component system on the bacterial surface, AgrC and AgrA. AgrC is the membrane histidine kinase receptor and AgrA is a response regulator- upon binding of AIP, AgrC phosphorylates AgrA.AIP accumulates during growth activating an AgrC and AgrA cascade when it reaches a critical signal level. This cascade activates P2 and P3 promoters which autoactivate the agr system and upregulate RNAIII transcription. RNAIII regulates the expression of virulence factors including toxins, super-antigens, and exo-enzymes. Extensive research to identify AIP:AgrC inhibitors aims to find therapeutics against pathogens.AgrD is the precursor peptide of AIP, and AgrB is an integral membrane endopeptidase essential to biosynthesize AIP. This AIP system is conserved among many Gram-positive bacteria. S. aureus strains are categorized into four groups (I-IV) according to their AIP signal and cognate extracellular receptor, AgrC.AIP-II has the conserved thiolactone macrocycle of the AIP family. Asn-3, Leu-8, and Phe-9 have been shown to be critical for activation of the agr response while inhibition relies on Leu-8 and Phe-9. The reactive thiol ester bond is only necessary for activation of the agr response. Further work may provide further AIP:AgrC inhibitors.
    Colore e forma:Powder
    Peso molecolare:878.4 g/mol

    Ref: 3D-CRB1001687

    1mg
    470,00€
    500µg
    386,00€
  • PR9


    CPPs can transport molecules such as nucleic acids, proteins and imaging agents into cells of interest. PR9, Pas non-arginine, is an arginine rich CPP. It is composed of the nona-arginine: R9 and Pas which is a peptide penetrating accelerating sequence and it functions to export molecules out of endocytic vesicles. During a study in which PR9 was in complex with a Quantum dot probe (QD) it was evident that the PR9/QD complex was transported into the cell through endocytosis and co-localises with actins, lysosomes, early endosomes and the nucleus. Due to the non-toxicity of the PR9/QD complex it can be used as a safe vector for biomedical purposes.

    Peso molecolare:2,224.4 g/mol

    Ref: 3D-CRB1001300

    1mg
    282,00€
    500µg
    206,00€
  • B-peptide


    B-peptide is an arginine-rich cell-penetrating peptide which can be used in a chimeric fusion peptide which includes a morpholino oligomer (PMO). B-peptide enables the convalently conjugated PMOs or peptides to be transported across cell membranes and can therefore be a useful tool in delivering targeted therapies.

    Peso molecolare:1,861.2 g/mol

    Ref: 3D-CRB1001582

    1mg
    282,00€
    500µg
    206,00€
  • LL-17-32


    This peptide represents the anti-microbial domain of the LL-37 peptide. LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37- this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also has anti-cancer properties and regulates many aspects of the innate immune system, overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis.
    Peso molecolare:2,044.2 g/mol

    Ref: 3D-CRB1000036

    1mg
    282,00€
    500µg
    206,00€
  • Galanin (2-30) acid


    Galanin is predominantly an inhibitory neuropeptide expressed in humans and other mammals' brains, spinal cords, and gut. Galanin signalling occurs through three G protein-coupled receptors GalR1-3. Galanin has been implicated in many biologically diverse functions, including nociception, waking and sleep regulation, cognition, feeding, mood regulation and blood pressure regulation. Galanin appears to have neuroprotective activity as its biosynthesis is increased 2-10 fold upon axotomy and during seizure activity in peripheral tissues and the brain.The clinical relevance of galanin is related to several chronic neural disorders, including Alzheimer's disease, epilepsy, depression and cancer- those who suffer from type 2 diabetes mellitus, depression and Alzheimer's disease often express high levels of galanin. Conversely, intervention with galanin agonists (for example, M617, M1145 and M1153) were able to ameliorate disease symptoms such as Alzheimer's and have pro-nociceptive effects. Specifically, activation of GAL2 can alleviate such disease features in human and rodent models. This galanin (2-30) peptide has been used to characterise Galanin's binding sites and affinity for GALR receptors via competition binding analysis. Galanin (2-30) is a full agonist of the GALR2 receptor compared to its affinity for GALR1.
    Peso molecolare:3,098.5 g/mol

    Ref: 3D-CRB1001318

    1mg
    470,00€
    500µg
    386,00€
  • [5-FAM]-DAG peptide


    Cyclic DAG peptide targets connective tissue growth factor (CTGF/CCN2), present in the extracellular matrix, endothelial cells and overexpressed in several brain diseases. CTGF is a matricellular protein that acts as a regulator of several cellular functions, including cell adhesion, migration, mitogenesis, differentiation, and survival. CTGF is up regulated in Alzheimer's disease, Parkinson's disease, brain injury, glioblastoma, and cerebral infarction.DAG peptide has been shown to home to the brain in mouse models of glioblastoma, traumatic brain injury, and Parkinson's disease when exogenously delivered, making it an attractive target for the treatment of glioblastoma and other brain disorders. DAG may be of use as a tool to enhance delivery of therapeutics and imaging agents to sites of brain diseases.Peptide is labelled with an N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.
    Peso molecolare:1,363.5 g/mol

    Ref: 3D-CRB1100887

    1mg
    386,00€
    100µg
    206,00€
    500µg
    282,00€
  • nef protein fragment (Acetyl/amide) [Human immunodeficiency virus 1]


    Nef is an accessory protein highly conserved amongst all primate lentiviruses, it is essential for viral replication in vivo- it is expressed by human immunodeficiency virus (HIV) HIV-1 and HIV-2. Nef acts as a downregulator of class I human leukocyte antigens (HLA) expression in HIV-infected cells to help circumvent the immune response, such as Cytotoxic T lymphocytes (CTL) activity. An intact nef gene is critical for high viral loads, linked to development of acquired immunodeficiency syndrome (AIDS). Certain alleles of HLA have been associated with maintaining a seronegative status such as HLA-A*1101.This nef peptide sequence contains the region considered to be a a C-proximal adaptor-protein (AP) interaction site. The presence of various nef motifs such as this are an intense area of investigation to understand if they are a factor in patients who remain clinically asymptomatic. This nef fragment is provided with an N-terminal acetyl group to increase its stability.

    Peso molecolare:1,135.6 g/mol

    Ref: 3D-CRB1001225

    1mg
    282,00€
    500µg
    206,00€
  • C7


    Selective peptide ligand for FRalpha, demonstrating specific binding to FRalpha expression cells and tumour targeting ability in vivo.
    Peso molecolare:1,374.7 g/mol

    Ref: 3D-CRB1001181

    1mg
    282,00€
    500µg
    206,00€
  • SARS-CoV-2 Nucleoprotein (353-370)


    The coronavirus (CoV) nucleoprotein is the major component of CoV structural proteins. Also known as the nucleocapsid protein, it is an abundant RNA-binding protein critical for viral genome packaging. These factors make nucleoprotein a good target for developing new antiviral drugs. In addition, the identification of epitopes within the nucleoprotein sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. Nucleoprotein (353-370) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.

    Peso molecolare:2,111.1 g/mol

    Ref: 3D-CRB1001836

    1mg
    282,00€
    500µg
    206,00€
  • Jelleine 2


    Jelleines are a family of very small (8-9 amino acid residues long) host defence peptides (HDPs) isolated from the royal jelly of honey bees (Apis mellifera). Jelleines do not present any similarity with other HDPs from other honeybees and are produced by the workers and secreted into Royal Jelly (RJ), providing abroad-spectrum protection of the bee hive against microbial infections. The Jelleines are not considered cytolytic or directly involved with inflammatory effects. Jelleine-II may be a product of a tryptic digestion of MRJP-1, which is produced in the hypopharyngeal glands of the worker honeybee and secreted into the RJ- an exoproteinase action either on N-or on C-terminal positions of the tryptic fragment could result in the formation of the Jelleines-I and -IV, respectively. Possess antimicrobial properties against yeast, fungi, gram-positive and gram-negative bacteria.PLEASE NOTE that in several published articles the sequence of Jelleine-2 has been printed as TPFKISLHL-NH2-NH2, due to a mistake in the original reference: Fontana et al., (2004). The correct sequence, is TPFKISIHL-NH2.

    Peso molecolare:1,053.6 g/mol

    Ref: 3D-CRB1001558

    1mg
    282,00€
    500µg
    206,00€
  • PD-1 (21-35)


    PD-1 (21-35) peptide is derived from the programmed cell death-1 (PD-1) which interacts with its ligand, PD-L1 to regulate immune homeostasis. PD-1 and its ligand PD-L1 are critical in regulating T cell activation, tolerance and immuno-pathology. PD-1 is an immune checkpoint and guards against autoimmunity through two mechanisms. First, it promotes apoptosis of antigen-specific T-cells in lymph nodes. Second, it reduces apoptosis in regulatory T cells.Several types of cancer cells overexpress PD-L1 in order to escape from the PD-1/PD-L1 immuno-surveillance mechanism. Consequently PD-1 inhibitors and PD-L1 inhibitors could be used as a therapeutic in the treatment of cancers.

    Colore e forma:Powder
    Peso molecolare:1,778.9 g/mol

    Ref: 3D-CRB1000338

    1mg
    282,00€
    500µg
    206,00€
  • Fmoc-ß-Ala-Wang Resin (100-200 mesh) 1% DVB


    Fmoc-ß-Ala-Wang Resin (100-200 mesh) 1% DVB is a high purity reagent for peptide synthesis. It is used in the production of cell biology research tools, such as inhibitors and activators of ion channels, ligands for receptor binding, and antibodies. Fmoc-ß-Ala-Wang Resin (100-200 mesh) 1% DVB is a reagent that is used to synthesize peptides. This resin can be used in the production of various types of research tools, including inhibitors and activators of ion channels, ligands for receptor binding, and antibodies.
    Purezza:Min. 95%

    Ref: 3D-RFX-1344-PI

    1g
    136,00€
    5g
    218,00€
  • SARS-CoV-2 ORF3a (26-40)


    SARS-CoV-2 ORF3a (26-40)
    Peso molecolare:1,575.8 g/mol

    Ref: 3D-CRB1001824

    1mg
    282,00€
    500µg
    206,00€
  • BDC2.5 mimotope 1040-51


    BDC2.5 mimotope 1040-51 is a mimotope of BDC2.5 T cells which can recognise glutamic acid decarboxylase epitopes.
    Colore e forma:Powder
    Peso molecolare:1,297.7 g/mol

    Ref: 3D-CRB1001402

    1mg
    282,00€
    500µg
    206,00€
  • ANP 1-28 Human


    ANP (1-28) is derived from the atrial natriuretic peptide (ANP) which is a cardiac hormone involved in maintaining cardio-renal homeostasis. This occurs through the activation of the guanylyl cyclase-coupled receptor, resulting in the increased concentration of cyclic guanylate monophosphate. Moreover its function in the processes of anti-proliferation and anti-angiogenesis allow it to take part in cardiovascular remodelling.ANP is a member of the natriuretic peptide family and it is encoded by the NPPA gene, located on chromosome 1. Once synthesized from the 151 amino acid pre-prohormone into its biologically active form, ANP is secreted by the atrial cardiomyocytes in the circulating forms: ANP (1-98) and ANP (99-126). This synthesis process involves the signal peptide being removed from the pre-prohormone resulting in pro-ANP (1-126) which is converted into the circulating forms by the type II transmembrane serine protease Corin.

    Peso molecolare:3,078.4 g/mol

    Ref: 3D-CRB1000136

    1mg
    470,00€
    500µg
    386,00€
  • Syntide 2


    Syntide-2 is a substrate peptide which was specifically designed to be homologous to site 2 in glycogen synthase. Syntide-2 is therefore phosphorylated by Ca2+ calmodulin-dependent protein kinase II as well as other calcium dependant kinases and protein kinase C. Synthase-2 can also be phosphorylated by CAMP-dependent protein kinase and to a lesser extent- phosphorylase kinase, but not by myosin light chain kinase.

    Colore e forma:Powder
    Peso molecolare:1,506.9 g/mol

    Ref: 3D-CRB1000602

    1mg
    282,00€
    500µg
    206,00€
  • PTH (1-34) human


    PTH 1-34, is a biologically active peptide fragment of parathyroid hormone (PTH). PHT 1-34 has been shown to enhance bone fracture healing by promoting osteogenesis. PTH 1-34 also has chondrogenic properties.PTH is an 84-amino-acid polypeptide hormone (PTH 1-84) which is secreted by the parathyroid glands along with its fragments (such as PTH 1-34 and PTH 7-84). PTH increases calcium and decrease phosphate levels in the blood and the abundance of PTH-derived peptides is regulated by blood calcium levels. PTH inhibits the bone growth-promoting activity of osteoblasts and induces osteoclasts to resorb bone and release calcium and phosphate ions into the blood. PTH binds to and activates the receptor parathyroid hormone receptor 1 (PTHR1). PTHR1 is a G-protein-coupled receptor (GPCR) which regulates mineral ion homeostasis, bone turnover and skeletal development.
    Colore e forma:Powder
    Peso molecolare:4,115.1 g/mol

    Ref: 3D-CRB1000854

    1mg
    282,00€
    500µg
    206,00€
  • SARS-CoV-2 Membrane protein (172-188)


    SARS-CoV-2 Membrane protein (172-188)

    Colore e forma:Powder
    Peso molecolare:1,900 g/mol

    Ref: 3D-CRB1001838

    1mg
    282,00€
    500µg
    206,00€
  • OVA (251-264)


    Ovalbumin (OVA) is the primary protein in egg-white, and is involved in initiating food allergies and asthma. It is a highly immunogenic protein and can be used for peptide conjugation in the development of antibodies.OVA (251-264) is a class I (Kb)-restricted peptide epitope of OVA. The ovalbumin fragment is presented by the class I MHC molecule, H-2Kb.

    Peso molecolare:1,631.9 g/mol

    Ref: 3D-CRB1001101

    1mg
    282,00€
    500µg
    206,00€
  • [5-FAM]-(RXR)4XB


    (RXR)4XB is a cationic membrane-penetrating peptide and is effective in delivering phosphorodiamidate morpholino oligonucleotides (PMOs) into eukaryotic cells such as Escherichia coli. It contains 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.

    Peso molecolare:2,260.3 g/mol

    Ref: 3D-CRB1101020

    1mg
    282,00€
    500µg
    206,00€
  • EC dipeptide


    EC-acid has a formal charge of 0 and a range of biological and chemical uses. CE-acid is also available in our catalogue.
    Peso molecolare:250.1 g/mol

    Ref: 3D-CRB1001692

    1mg
    282,00€
    500µg
    206,00€
  • Cys(Npys)-Antennapedia peptide, amide


    Identification of cell penetrating conjugates has aided numerous areas of scientific development. The Drosophila transcription factor Antennapedia contains a homeodomain that can be internalised by cells to the cytoplasm and to the nucleus in a receptor-independent mechanism. The key residues for internalisation have been sequenced (RQIKIWFQNRRMKWKK) and used in several studies to aid entry of recombinant proteins into cells. The peptide sequence described, known as penetratin, was fused to a ligand for Grb-2 resulting in inhibition of downstream Grb-2 signalling events.- Penetratin has also been used in vivo to prime cytotoxic T lymphocytes by conjugating short antigenic peptides to the cell penetrating peptide.On this sequence the N terminal active cysteine has been protected by a 3-Nitro-2-pyridinesulfenyl group. This is a useful modification as it allows this peptide to be used as a carrier peptide in conjugation reactions- this is a particularly useful modification when the peptide-like molecule contains a free thiol group.

    Peso molecolare:2,501.3 g/mol

    Ref: 3D-CRB1000180

    1mg
    470,00€
    500µg
    206,00€
  • Vitronectin (367-378)

    CAS:

    Peptide derived from vitronectin, the mammalian glycoprotein which plays a key role in tissue repair and remodelling. Its properties as an adhesive protein allow mammalian cells in serum to interact with culture vessels.

    Formula:C70H122N32O16
    Peso molecolare:1,667.93 g/mol

    Ref: 3D-CRB1000729

    1mg
    282,00€
    500µg
    206,00€
  • PTH (1-13) Human


    N-terminal tryptic peptide of parathyroid hormone (PTH), used for quantification and optimisation in LC-MS/MS assays.PTH is an 84-amino-acid polypeptide hormone (PTH 1-84) which is secreted by the parathyroid glands along with its fragments (such as PTH 1-34 and PTH 7-84). PTH increases calcium and decrease phosphate levels in the blood and the abundance of PTH-derived peptides is regulated by blood calcium levels. PTH inhibits the bone growth-promoting activity of osteoblasts and induces osteoclasts to resorb bone and release calcium and phosphate ions into the blood. PTH binds to and activates the receptor parathyroid hormone receptor 1 (PTHR1). PTHR1 is a G-protein-coupled receptor (GPCR) which regulates mineral ion homeostasis, bone turnover and skeletal development

    Peso molecolare:1,454.8 g/mol

    Ref: 3D-CRB1000436

    1mg
    282,00€
    500µg
    206,00€
  • Acetyl-HIV-1 reverse transcriptase (A2-YI9)


    HIV-1 replication is rapid and error prone which is beneficial to the virus as it allows mutations to arise that aid evasion of the host immune system and resistance to drug treatment. RT is the key target for most anti-HIV drugs and therefore conserved sequences are useful to aid further research into new less toxic antiviral treatments.  HIV-1 reverse transcriptase (RT) converts the RNA genome into DNA during retroviral replication. HIV-1 RT is a heterodimer composed of 2 subunits, p66 and p51. HIV-1 RT heterodimer has 2 enzymatic functions, DNA polymerase and Rnase H resulting in nucleic acid translation to a linear DNA duplex. Complete inhibition of viral replication is the only known method of preventing HIV-1 drug resistance and disease progression.HIV RT epitopes have become a useful research tool as an in vitro antigenic challenge to study cytotoxic T lymphocyte (CTL) responses to retroviruses. The HIV-1 RT A2-YI9 sequence has been shown to be an effective epitope for CTL recognition leading to lysis of HIV-infected T cells. The A2-YI9 is also considered a potential for vaccine development due to it being a well conserved sequence. Synthesised HIV-1 RT A2-YI9 is provided here with N-terminal acetylation to mimic the charge of the native peptide more closely. The epitope is also available without acetylation from our catalogue.

    Ref: 3D-CRB1001657

    1mg
    282,00€
    500µg
    206,00€
  • CBL (167-180) Light


    CBL (167-180) is derived from the CBL E3 ubiquitin ligase which targets receptor tyrosine kinases to lysosome degradation. CBL and its family member CBL-B are expressed in hematopoietic cells and as E3 ubiquitin ligases they contain a tyrosine kinase domain and an RF domain joined by a linker domain. The function of the RF domain is to transfer ubiquitin from E2 ubiquitin-conjugating enzymes onto the target protein which is often phosphorylated. Consequently the ubiquitinated substrate, the receptor tyrosine kinases, are ultimately targeted to the lysosome for degradation.EGFR is an example of a receptor tyrosine kinase whose activation is prevented by CBL and CBL-B when they bind and recruit GRb2, the adapter protein to EGFR. Consequently the ubiquitinylation of EGFR occurs and targets it for recognition by the endosomal protein complex and then lysosome degradation.It has also been found that the CBL family can negatively regulate through ubiquitinylation, PI 3-kinases, Rap G-protein guanine nucleotide exchange factor (GEF), C3G and Rho GTPase GEF Vav which are all non-receptors.If CBL becomes non-functional it can be associated with malignancies such as acute myeloid leukemia and myelodysplastic syndrome.

    Peso molecolare:1,540.8 g/mol

    Ref: 3D-CRB1000950

    25nMol
    206,00€
  • Histone H3 (1-22) K9Me1-Biotin


    Histone H3 (1-22) K9Me1-Biotin is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.Another modification process histones can undergo is biotinylation where the covalent attachment of a biotin molecule is catalysed by the enzyme Biotinidase. This cleaves biocytin to generate a biotinyl-thiester intermediate. The biotinyl can then be transferred onto the histone lysine ɛ-amino group which in this case it is covalently attached to Histone 3. Overall the biotinylation sites identified in histone 3 are: K4, K9 and K18. The presence of biotinylated histones have been detected in human cells such as lymphocytes and lymphomas.
    Colore e forma:Powder
    Peso molecolare:2,823.7 g/mol

    Ref: 3D-CRB1000483

    1mg
    470,00€
    500µg
    386,00€
  • [Sulfo-Cyanine3]-LifeAct (Abp140 1-17)


    [Sulfo-Cyanine3]-LifeAct (Abp140 1-17) contains the fluorophore sulfo-cyanine3 and the 17 amino acid peptide lifeact derived from amino acids 1-17 of the Saccharomyces cerevisiae actin binding protein, Abp140. These first 17 amino acids of Abp140 are crucial in allowing lifeact to localise to actin filaments (F-actin) and therefore it can be used as a cytoskeletal marker. One application of lifeact is in the study of plant development and pathogen defence as filamentous actin within the plant's actin cytoskeleton is important in key processes such as cell division, membrane trafficking and stomatal movements. The addition of Atto655 which has single molecule (SM) imaging properties allows the location of lifeAct (Abp140 1-17) binding to be detected.
    Peso molecolare:2,521.2 g/mol

    Ref: 3D-CRB1130630

    100µg
    470,00€
    500µg
    891,00€
  • EBV EBNA3B (416-424) (HLA-A11)


    Portion of EBV

    Peso molecolare:1,020.6 g/mol

    Ref: 3D-CRB1001464

    1mg
    282,00€
    500µg
    206,00€
  • MOG (92-106) Mouse, Rat


    Myelin oligodendrocyte glycoprotein (MOG) is a member of the immunoglobulin (Ig) protein superfamily and is expressed exclusively in the central nervous system (CNS) on the surface of myelin sheaths and oligodendrocyte processes. MOG is expressed at the onset of myelination, and therefore is a potential marker for oligodendrocyte maturation.MOG contains an extracellular domain, a transmembrane domain, a cytoplasmic loop, a membrane-associated region and a cytoplasmic tail.- MOG may function as a cell surface receptor or cell adhesion molecule. -Fifteen different alternatively spliced isoforms have been detected in humans. These are present either on the cell surface, the endoplasmic reticulum in the endocytic system, or in secreted form.The secreted form of MOG may trigger autoimmunity if released into the cerebrospinal fluid and periphery. MOG is thought to be a key target for autoantibodies and cell-mediated immune responses in inflammatory demyelinating diseases such as multiple sclerosis (MS) and is therefore widely studied in this field.Fragment 92-106 of MOG is able to induce experimental autoimmune/allergic encephalomyelitis (EAE), an animal model that resembles MS.
    Colore e forma:Powder
    Peso molecolare:1,823.9 g/mol

    Ref: 3D-CRB1000330

    1mg
    282,00€
    500µg
    206,00€
  • HPV16 E7 (86-93)


    Immunogenic Human Cytotoxic T lymphocytes (CTL) epitope encoded by human papillomavirus 16 type E7 with very high affinity binding to the HLA-A*0201 molecule.

    Colore e forma:Powder
    Peso molecolare:814.5 g/mol

    Ref: 3D-CRB1001411

    1mg
    282,00€
    500µg
    206,00€
  • HPV E7 protein (49-57)


    Human Papillomavirus (HPV) E7 protein (49-57) immunogenic Human Cytotoxic T lymphocytes (CTL) epitope encoded by human papillomavirus 16 type E7 with very high affinity binding to defined HLA molecule. CEF control peptides are the gold standard for effectively stimulating adaptive immune cells in cytokine assays.

    Colore e forma:Powder
    Peso molecolare:1,119.6 g/mol

    Ref: 3D-CRB1001123

    1mg
    282,00€
    500µg
    206,00€
  • Kallikrein-2 inhibitor


    Kallikrein-2 inhibitor
    Peso molecolare:891.5 g/mol

    Ref: 3D-CRB1001723

    1mg
    282,00€
    500µg
    206,00€
  • Balteatide


    Balteatide is a novel antimicrobial peptide (AMP) isolated from the skin secretion of wild Peruvian purple-sided leaf frogs,-Phyllomedusa baltea. Balteatide has activity against the Gram-positive bacterium,-Staphylococcus aureus- the Gram-negative bacterium,-Escherichia coli- and the yeast,-Candida albicans- against which, unusually, it is most potent. Bateatide is also devoid of haemolytic activity up to concentrations of 512 mg/L.Balteatide is C-terminally amidated which is common in AMP as it effectively removes a membrane-repelling negative charge and replaces it with a hydrophobic membrane-interacting group. AMPs are a fundamental component of innate immunity/molecular defence across most forms of life and act in a membranolytic fashion to destroy the integrity of microorganisms.Balteatide differs from the myotropic peptide, sauvatide, by just one amino acid (I at position 9 in balteatide and T in sauvatide), however sauvatide displayed little or no antimicrobial activity and balteatide is devoid of myotropic activity.

    Peso molecolare:1,176.8 g/mol

    Ref: 3D-CRB1000491

    1mg
    282,00€
    500µg
    206,00€
  • MyHC (614-629)


    Peptide derived from the myosin heavy-chain (MyHC) proteins which are differentially expressed in mammalian skeletal muscles.

    Peso molecolare:2,073.40 g/mol

    Ref: 3D-CRB1001061

    1mg
    282,00€
    5mg
    891,00€
    500µg
    206,00€
  • Bradykinin


    Bradykinins and their associated kinins are inflammatory mediators produced during inflammation. The two main kinins in mammals are the nonapeptide bradykinin, BK (1-9) and the decapeptide kallidin (KD), [Lys0]-BK(1-10). Their biological actions are mediated by two distinct receptors, termed B1 and B2.-BK is involved in several pathophysiological processes, such as inflammation, pain, cell proliferation, and tumours. It plays a crucial role in corneal epithelial cells, corneal stromal cells, and fibroblasts.Inflammation has been reported as one significant hallmark of breast cancer in relation to tumour development, metastasis, and invasion. The bradykinin receptor 1 (B1R) associated with kallidin is highly expressed on inflammatory breast tumour cells thus providing a promising targeting site for tumour recognition and sufficient receptor mediated endocytosis.
    Peso molecolare:1,059.6 g/mol

    Ref: 3D-CRB1001522

    1mg
    282,00€
    500µg
    206,00€
  • [5-FAM]-TAT


    [5-FAM]-TAT is a cell penetrating cationic peptide derived from the N-terminus of the Tat protein, which is a trans-activator of the transcription protein present in the human immunodeficiency virus (HIV). Specifically TAT (47-57) is located within the arginine-rich basic domain 48-60 of the TAT peptide which as a whole has three domains which function to aid HIV through transactivation, DNA binding and nuclear transport. As a cell penetrating peptide (CPP) TAT aids in the cellular uptake of molecules and hence serves a valuable purpose in transduction methods. This property has been demonstrated through its ability of allowing toxins such as the neurotoxin Botulinum neurotoxin Type A, produced by the Clostridium botulinum type A bacteria to penetrate the skin barrier non-invasively. Additionally TAT (47-57) can be used to deliver proteins, fluorophores, chelators and DNA to target cells.It contains 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.
    Peso molecolare:2,172.2 g/mol

    Ref: 3D-CRB1101019

    1mg
    386,00€
    100µg
    206,00€
    500µg
    282,00€
  • Click (AAKK)4


    Small peptide design has become of interest to catalyse chemical transformations within the cell. The aim is to generate peptides to enhance the hybridization of attached oligonucleotides to complementary DNA sequences. (AAKK)4 is modelled on the surface of staphylococcal nuclease, it a short cationic lysine-rich peptide that can deliver a nucleophile to DNA or RNA. (AAKK)4 peptide can improve DNA-PNA (peptide nucleic acid) hybridisations dramatically as well as increase strand invasion rate. (AAKK)4 peptide is a non-lipid approach for cell penetration which is preferable for certain cell lines due to cytotoxicity issues. (AAKK)4-antisense conjugates have been used to silence gene expression.(AAKK)4 is provided here with a N-terminal alkyne attachment. Two of the most regularly encountered functional groups for click chemistry are azides and alkynes, and the azide-alkyne cycloaddition has become the most popular click reaction. The use of click chemistry with alkyne-(AAKK)4 allows a wide variety of applications particularly for conjugation, modification, and peptide design.

    Colore e forma:Powder
    Peso molecolare:1,690.1 g/mol

    Ref: 3D-CRB1000117

    1mg
    282,00€
    500µg
    206,00€
  • MBP (69-88)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecolare:2,316.5 g/mol

    Ref: 3D-PP51059

    ne
    Prezzo su richiesta
  • CMVpp65 - 13 (RVSQPSLILVSQYTP)


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
    Peso molecolare:1,688 g/mol

    Ref: 3D-PP50988

    ne
    Prezzo su richiesta
  • H-TAVNALWGK^-OH


    Peptide H-TAVNALWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP48211

    ne
    Prezzo su richiesta
  • SARS-CoV-2 NSP7 (1-15)


    SARS-CoV-2 NSP7 (1-15)

    Peso molecolare:1,595.8 g/mol

    Ref: 3D-CRB1001790

    1mg
    282,00€
    500µg
    206,00€
  • beta-Amyloid (1-16) Human


    Amyloid β-peptide (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD. Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.

    Peso molecolare:1,955.01 g/mol

    Ref: 3D-CRB1000083

    1mg
    282,00€
    500µg
    206,00€
  • PAR-2 receptor agonist


    Protease activated receptors (PARs) are a distinctive four-member family of seven transmembrane G protein-coupled receptors (GPCRs) widely expressed in inflammatory cells. PARs are cleaved by certain serine proteases to expose a tethered ligand domain, this ligand domain then binds to and activates the receptors to initiate multiple signalling cascades. These PAR-activating proteases therefore represent PAR agonists. This PAR-2 agonist peptide represents the sequence of the 'tethered ligand' and is therefore capable of activating the receptor independently of N-terminal proteolysis.This peptide has been shown to elicit a range of cellular responses including- histamine release from skin mast cells- IL-8 and lactoferrin secretion from peripheral blood neutrophils- increased vascular cell adhesion molecule-1 (VCAM-1) expression- release of IL-8 and granulocyte colony-stimulating factor (G-CSF) from bronchial fibroblasts- secretion of granulocyte-macrophage colony-stimulating factor (GM-CSF), intercellular adhesion molecule 1 (ICAM-1), tumour necrosis factor alpha (TNF-α), matrix metalloproteinase-1 (MMP-1), and MMP-10 from epithelial cells- and production of thymic stromal lymphopoietin (TSLP) in the skin of mice and its release from T cells.PAR activation has been linked to inflammation and an increase in PAR-2 expression is seen in patients with septic shock.- Therefore compounds that-mimic or interfere with the PAR-activating processes are attractive therapeutic candidates.

    Colore e forma:Powder
    Peso molecolare:614.4 g/mol

    Ref: 3D-CRB1000987

    1mg
    206,00€
    5mg
    281,00€
  • SARS-CoV-2 ORF7a-10 (69-86)


    ORF7a is an accessory protein that is key to SARS-CoV-2 evading the immune system. ORF7a acts on the secretory pathway to lower surface MHC-I expression by specifically interacting with the MHC-I heavy chain and delaying its export from the endoplasmic reticulum. These factors make the ORF6 protein a viable target for developing new antiviral drugs. In addition, the identification of epitopes within the ORF7a-10 protein sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. ORF7a-10 protein (69-86) is an epitope candidate with various predicted HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.
    Peso molecolare:2,052.2 g/mol

    Ref: 3D-CRB1001840

    1mg
    282,00€
    500µg
    206,00€
  • Cyclo(Arg-Ala-Asp-D-Tyr-Lys)


    Cyclo(Arg-Ala-Asp-D-Tyr-Lys) is a peptide macrocycle that has been shown to have potent anti-cancer activity. It binds to the receptor for epidermal growth factor (EGF), which is overexpressed in many cancers, and inhibits its function. Cyclo(Arg-Ala-Asp-D-Tyr-Lys) is also able to inhibit the production of nitric oxide by inhibiting the synthesis of arginase. This peptide has also been shown to induce apoptosis in cancer cells by altering the mitochondrial membrane potential and activating caspases 3 and 9.
    Formula:C28H43N9O8
    Purezza:Min. 95%
    Peso molecolare:633.70 g/mol

    Ref: 3D-PCI-3894-PI

    1mg
    136,00€
    5mg
    328,00€
    25mg
    1.032,00€
  • Biotin gliadin-derived peptide


    Biotin gliadin-derived peptides derived from Gliadin peptides, the component of wheat involved in the gastrointestinal symptoms of wheat allergy and Celiac Disease (CD). During wheat allergies histamines and leukotrienes are secreted due to gliadin peptide sequences cross-linking two IgE molecules on mast cells and basophils.The glutamine and proline rich peptides of which Gliadin is composed of are resistant to proteolysis during digestion, leaving them active in the gastrointestinal tract. Subsequently these are deamidated by tissue transglutaminase and can bind to HLA-DQ2 or DQ8. As a result in patients with the autoimmune disease CD, there is a Th-mediated inflammatory immune response against these gliadin peptides.Gliadin can exert additional effects on the intestinal microbiota and ileal barrier function. It has been found that gut microbiota members such as Bifidobacterium and lactobacillus have the ability to digest and inactivate gliadin peptides hence reducing their inflammatory effects in the gastrointestinal system.Here Biotin (B7) has been added. Biotin is a cofactor for several mammalian biotin-dependent carboxylases which are involved in processes such as gluconeogenesis, amino acid metabolism and fatty acid synthesis.
    Colore e forma:Powder
    Peso molecolare:1,564.7 g/mol

    Ref: 3D-CRB1000477

    1mg
    282,00€
    500µg
    206,00€
  • Histone H3 (1-18)


    Histone H3 (1-18) is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.

    Colore e forma:Powder
    Peso molecolare:1,942.23 g/mol

    Ref: 3D-CRB1000266

    1mg
    282,00€
    500µg
    206,00€
  • PMX 205


    C5a receptor peptide antagonist which can ameliorate experimentally-induced colon inflammation in mice. It can also reduce fibrillar amyloid deposits, decrease hyperphosphorylated tau levels and rescue cognitive function in a mouse model of Alzheimer's Disease. Also improves hindlimb grip strength and slows disease progression in the hSOD1G93A-mouse model of amyotrophic lateral sclerosis. Orally active and brain penetrant.

    Peso molecolare:838.5 g/mol

    Ref: 3D-CRB1001059

    1mg
    282,00€
    500µg
    206,00€
  • Leu-AFC.HCl


    Aminopeptidase fluorogenic substrate. Upon cleavage of the bond between leucine and the 7-amino-4-trifluoromethylcoumarin (AFC) group an increase in fluorescence between 495-505nm can be detected using an excitation wavelength of 395-400nm.
    Peso molecolare:378.77 g/mol

    Ref: 3D-CRB1100264

    1mg
    282,00€
    5mg
    891,00€
    500µg
    206,00€
  • ACT1


    α-connexin carboxyl terminal peptide that specifically targets and maintains Cx43 at gap junction sites between cell-cell membrane borders of breast cancer cell.- Thus it augments gap junction activity and impairs proliferation and survival of breast cancer cells with no effect on non-transformed cells.

    Peso molecolare:3,255.8 g/mol

    Ref: 3D-CRB1001536

    1mg
    386,00€
    500µg
    282,00€
  • [5-FAM]-RKOpep


    Peptide identified through phage display that binds to colorectal cancer cell line RKO cells, as well as other cancer cells including Caco-2, HCT 116 and HCT-15, but not to normal cells, possibly through targeting the monocarboxylate transporter 1, which has been implicated in colorectal cancer progression and prognosis. It contains 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.
    Peso molecolare:1,278.4 g/mol

    Ref: 3D-CRB1101540

    1mg
    386,00€
    500µg
    282,00€
  • [TAMRA]-beta-Amyloid (1-15) Human


    Amyloid β 1-15 (Aβ1-15) is one of many short Aβ species found in vivo and is formed by the cleavage of amyloid β precursor protein by β- and alpha-secretase.Aβ has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.Contains an N-terminal Carboxytetramethylrhodamine (TAMRA) fluorophore. TAMRA is a pH-stable orange-red fluorescenct dye with good photostability.

    Peso molecolare:2,237.9 g/mol

    Ref: 3D-CRB1100840

    1mg
    386,00€
    100µg
    206,00€
    500µg
    282,00€
  • TAT (47-57)

    CAS:

    Tat (47-57) is a cell penetrating cationic peptide derived from the N-terminus of the Tat protein, which is a trans-activator of the transcription protein present in the human immunodeficiency virus (HIV). Specifically TAT (47-57) is located within the arginine-rich basic domain 48-60 of the TAT peptide which as a whole has three domains which function to aid HIV through transactivation, DNA binding and nuclear transport. As a cell penetrating peptide (CPP) TAT aids in the cellular uptake of molecules and hence serves a valuable purpose in transduction methods. This property has been demonstrated through its ability of allowing toxins such as the neurotoxin Botulinum neurotoxin Type A, produced by the Clostridium botulinum type A bacteria to penetrate the skin barrier non-invasively. Additionally TAT (47-57) can be used to deliver proteins, fluorophores, chelators and DNA to target cells.

    Formula:C64H118N32O14
    Colore e forma:Powder
    Peso molecolare:1,559.83 g/mol

    Ref: 3D-CRB1000171

    5mg
    202,00€
    10mg
    314,00€
    25mg
    505,00€
  • Ac-TTAI-NH2


    AAT is a highly abundant serine protease inhibitor primarily produced in the liver to protect the lung tissue. However, misfolding of AAT can result in significant liver disease, lung disease, and cancers. Defective AAT is characteristic of the misfolding protein diseases known as serpinopathies.Ion mobility mass spectrometry (IM-MS) was used to identify Ac-TTAI-amide as a ligand effecting α1-antitrypsin stability. Interaction of Ac-TTAI-amide with AAT results in increased stability and reduced polymerisation. Thus Ac-TTAI-amide is a useful target for further research in to serpinopathy management.
    Colore e forma:Powder
    Peso molecolare:445.3 g/mol

    Ref: 3D-CRB1000672

    1mg
    282,00€
    500µg
    206,00€
  • Suc-LLVY-[AMC]


    Fluorogenic substrate peptide of the 20S proteasome. In its intact state this peptide is non-fluorescent, however when aminomethylcoumarin (AMC) is released upon hydrolysation, fluorescence can be detected. This peptide is therefore a useful tool for analysing the activity of the 20S proteasome as well as other chymotrypsin-like proteases and calpains. This peptide is also a substrate for chymase, papain, carboxypeptidase Y, proteinase yscE (kexin) and ingensin.AMC is a fluorescent dye with excitation maxima at around 360 nm and emission maxima at around 450 nm. AMC can be excited with a mercury lamp and observed using a UV filter set.
    Colore e forma:Powder
    Peso molecolare:763.4 g/mol

    Ref: 3D-CRB1100485

    100µg
    346,00€
    500µg
    386,00€
  • Histatin-5


    Histatins are histidine rich cationic peptides produced in salivary glands and released into the saliva. The main histatins that make up more than 80% of histatins in saliva are histatin 1, histatin 3 and histatin 5. There are two histatin genes, one which encodes histatin 1, and one that encodes histatin 3, all other histatins are derivatives of these two histatins. Histatin 3 is a precursor of histatin 5, each with distinct roles.Histatin 5  is considered an antimicrobial peptide (AMP) as it has antibacterial activity as has been shown against opportunist infections such as P. aeruginosa, E. coli, and S. aureus. Histatin 5 also has potent anticandidal activity for example against Candida and Leishmania, it is shown to be the strongest antifungal of the histatins.  The antifungal activity functions by invasion of the microbe and entry to the mitochondria, histatin 5 then inhibits ATPase activity resulting in rapid depletion and ultimately bacterial cell death/apoptosis. As a salivary peptide, it inhibits Bacteroides gingivalis proteinase clostripain and protease activity microbe implicated in periodontal disease.
    Colore e forma:Powder
    Peso molecolare:3,036.29 g/mol

    Ref: 3D-CRB1000016

    1mg
    282,00€
    5mg
    651,00€
    500µg
    206,00€
  • H-GILFVGSGVSGGEEGAR^-OH


    Peptide H-GILFVGSGVSGGEEGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40345

    ne
    Prezzo su richiesta
  • GLP-1 (7-36) amide

    CAS:

    This is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide.  This peptide, human GLP-1 (7–36), shares the same sequence with preproglucagon (78-107), amide, human.

    Formula:C149H226N40O45
    Colore e forma:Powder
    Peso molecolare:3,297.63 g/mol

    Ref: 3D-CRB1000250

    1mg
    470,00€
    500µg
    386,00€
  • AcrAP1


    Venom peptidomes and proteomes have yielded significant novel drug discoveries. The non-disulphide bridge peptides (NDBPs) have become a particular focus due to their large range of structures as well as biological activity while retaining high specificity.In scorpion venom A. crassicauda, AcrAP1 was identified as a NDBP. Data shows it has antimicrobial activity against bacteria and yeast while also capable of haemolysing of horse erythrocytes. However, AcrAP1 did not affect the growth of the cancerous cell lines tested. Therefore, this peptide could be a useful model for modification to improve its potency. Furthermore, it may allow researchers to identify specific targets in disease pathways for new drug designs. A significant example of this, bradykinin-potentiating peptide Captopril® manages hypertension and originated from the conserved NDBP family.

    Peso molecolare:1,961.35 g/mol

    Ref: 3D-CRB1000028

    1mg
    282,00€
    500µg
    206,00€
  • IRBP (161-180)

    CAS:
    IRBP (161-180) derived from the interphotoreceptor retinoid-binding protein (IRBP), present in the interphotoreceptor matrix and is expressed by cone and rod photoreceptors in the eye. IRBP is involved in retinoid delivery and protects retinal cells from oxidative stress.In retinitis pigmentosa patients, IRBP can be subjected to mutations resulting in a non-secreted form of IRBP to be produced. Furthermore IRBP gene mutations have been associated with high myopia and retinal dystrophy.The expression of IRBP is reduced in diabetes patients which may lead to visual cycle misfunction and the photoreceptors can be vulnerable to damage.
    Formula:C103H157N25O29
    Colore e forma:Powder
    Peso molecolare:2,209.5 g/mol

    Ref: 3D-CRB1001412

    1mg
    282,00€
    500µg
    206,00€
  • [5-FAM]-Tp10


    TP10 is an amphipathic cell-penetrating peptide (CPPs) known as transportan 10. Its formation involves the use of a lysine residue to form a chimeric linkage between a mastoparan 21-residue peptide, a wasp venon 14-residue peptide and 6-residues derived from the neuropeptide galanin. Structurally TP10 contains only positively charged amino acids along with 4 lysines and an N-terminus. Therefore it will produce a +5 charge under conditions of a neutral pH. It has been found that TP10 may aid molecules in penetrating through the cell membrane barrier through directly interacting with the lipid bilayer. During these interactions with the membrane TP10 will form an amphipathic α-helix. Consequently TP10 can be used in transduction methods.It contains 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag.

    Peso molecolare:2,540.05 g/mol

    Ref: 3D-CRB1100282

    1mg
    386,00€
    100µg
    206,00€
    500µg
    282,00€
  • FEFEFKFK


    The ionic-complementary octapeptide, FEFEFKFK, can self-assemble into antiparallel β-sheet rich fibres and forms very stable hydrogels when at a concentration of more than 20 mg/mL (in water).These peptide hydrogels are naturally biocompatible and biodegradable and can be metabolised by the body. Such hydrogels have been shown to mimic the structure of the extracellular matrix, thus offering cells a niche to undertake their physiological functions. These properties mean that these hydrogels have the potential for use in medical applications.FEFEFKFK hydrogels are able to support the culture of cells such as mesenchymal stem cells in three dimensions with sustained cell viability. They can also support the differentiation into osteoblasts and promote mineralisation upon addition of osteogenic stimulation. They therefore have potential for use in the regeneration of hard tissues such as alveolar bone following injury or degeneration.

    Peso molecolare:1,120.6 g/mol

    Ref: 3D-CRB1001043

    1mg
    282,00€
    500µg
    206,00€
  • Histone H3 (1-20)-GG-[Lys(5-FAM)]


    Histone H3 (1-20)-GG-[Lys(5-FAM)] is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.Histone H3 (1-20)-GG-[Lys(5-FAM)] has a C-terminal GKK linker labelled with 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag. This peptide also has an uncharged C-terminal amide.

    Peso molecolare:2,781.5 g/mol

    Ref: 3D-CRB1101260

    1mg
    386,00€
    100µg
    206,00€
    500µg
    282,00€
  • HiBiT tag


    NanoLuc (Nluc) is an engineered luciferase protein which was developed from the luciferase of deep-sea shrimp (Oplophorus gracilirostris). This luciferase protein is considerably smaller than firefly or Renilla luciferase yet has higher luminescent intensity.In the NanoBiT assay system the NanoLuc luciferase protein has been separated into a large fragment, LgBiT, and a small fragment. HiBiT has a very similar amino acid sequence to the original small fragment and therefore has high specific affinity for the N-terminal large fragment, LgBiT. When these two fragments interact NanoLuc activity is restored. This system offers a novel alternative to conventional immunoblot analysis for the detection of protein expression when the HiBiT tag is added to the protein of interest and cell lysate is incubated with LgBiT. HiBiT peptide is capable of producing bright and quantitative luminescence through high affinity complementation with an 18 kDa subunit derived from NanoLuc (LgBiT).
    Colore e forma:Powder
    Peso molecolare:1,319.8 g/mol

    Ref: 3D-CRB1001507

    1mg
    348,00€
    500µg
    206,00€
  • Biotin phosphorylated JAK1 substrate peptide


    This peptide is phosphorylated by Janus kinase 1 (JAK1) and is an ideal substrate for use in kinase assays. The JAK family of kinases is essential for the signalling of a host of immune modulators in tumour, stromal, and immune cells where they are highly expressed. JAK family proteins mediate the signalling of the interferon (IFN), IL-6, and IL-2 families of cytokines.JAK kinases are associated with cytokine receptors. Cytokine binding to these receptors results in activation of JAK kinases and receptor phosphorylation. Phosphorylated cytokine receptors recruit STAT proteins, which are then phosphorylated by the activated JAK kinases. Phosphorylated STAT proteins form homo- and hetero-dimers that translocate into the nucleus and function as transcription factors.This JAK1 substrate peptide contains an N-terminal Biotin and a phospho-tyrosine residue
    Colore e forma:Powder
    Peso molecolare:2,238.9 g/mol

    Ref: 3D-CRB1001544

    1mg
    470,00€
    500µg
    386,00€
  • beta-Amyloid (1-40) Human


    Amyloid β-peptide (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS.Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.Aβ1-40 is a major C terminal variant of amyloid β constituting the most abundant AB peptide in the human brain.

    Peso molecolare:4,329.8 g/mol

    Ref: 3D-CRB1000087

    1mg
    651,00€
    5mg
    2.013,00€
    100µg
    386,00€
    500µg
    470,00€
  • Angiotensin II Antipeptide


    An angiotensin II (Ang-II) receptor antagonist, the sequence of the angiotensin II anti-peptide has been derived from the anti-sense mRNA complementary to the human Ang-II mRNA. The anti-peptide shares 50% sequence homology with Ang-II and acts to inhibit some of Ang-II's biological activities.Ang-II is a key signalling peptide of the renin angiotensin system (RAS), which is involved in regulating blood pressure, cardiovascular function and energy balance. RAS activity is elevated in obesity and is widely studied in relation to lifestyle-related diseases. Ang-II is produced from angiotensinogen (AGT) via the intermediate angiotensin I (Ang-I). AGTis cleaved by the aspartyl-protease, renin, to produce Ang-I, which is then cleaved by the dicarboxyl-peptidase angiotensin converting enzyme (ACE). ACE removes a histidine and a leucine, from the C-terminus of Ang-I to form Ang-II.Ang-II exerts its affect by binding to the G-protein-coupled receptors- Ang II type 1 (AT1) and Ang II type 2 (AT2) receptors. Ang-II plays central roles in glucose metabolism and blood pressure. Increased levels of Ang-II have also been associated with Alzheimer's disease, and certain cancers including oesophageal squamous cell carcinoma (ESCC), brain cancers and breast cancer. The effects of Ang-II appear to be supressed by another branch of the RAS- the ACE2/Ang-(1-7)/Mas pathway.

    Peso molecolare:898.5 g/mol

    Ref: 3D-CRB1000689

    1mg
    282,00€
    500µg
    206,00€
  • GP33 (1-9)


    Peptide derived from GP33, an epitope of the lymphocytic choriomeningitis virus (LCMV) which produces a CD8+ cytotoxic T lymphocyte response.

    Peso molecolare:973.16 g/mol

    Ref: 3D-CRB1001218

    1mg
    282,00€
    500µg
    206,00€
  • beta-Amyloid (35-25)


    This peptide represents the reserve sequence of β-amyloid 25-35 (Aβ 25-35) and is used as an inactive control peptide.Aβ has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer disease (AD) and Down syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.

    Peso molecolare:1,059.6 g/mol

    Ref: 3D-CRB1001040

    1mg
    282,00€
    500µg
    206,00€
  • CBL-B (22-37) Light


    CBL-B (22-37) is derived from the CBL-B E3 ubiquitin ligase which targets receptor tyrosine kinases to lysosome degradation. CBL-B and its family member CBL are expressed in hematopoietic cells and as E3 ubiquitin ligases they contain a tyrosine kinase domain and an RF domain joined by a linker domain. The function of the RF domain is to transfer ubiquitin from E2 ubiquitin-conjugating enzymes onto the target protein which is often phosphorylated. Consequently the ubiquitinated substrate, the receptor tyrosine kinases, are ultimately targeted to the lysosome for degradation.EGFR is an example of a receptor tyrosine kinase whose activation is prevented by CBL and CBL-B when they bind and recruit GRb2, the adapter protein to EGFR. Consequently the ubiquitinylation of EGFR occurs and targets it for recognition by the endosomal protein complex and then lysosome degradation.It has also been found that the CBL family can negatively regulate through ubiquitinylation, PI 3-kinases, Rap G-protein guanine nucleotide exchange factor (GEF), C3G and Rho GTPase GEF Vav which are all non-receptors.If CBL or CBL-B becomes non-functional it can be associated with malignancies such as acute myeloid leukemia and myelodysplastic syndrome.
    Peso molecolare:1,618.9 g/mol

    Ref: 3D-CRB1000942

    25nMol
    206,00€
  • PD-1 (24-38)


    PD-1 (24-38) peptide is derived from the programmed cell death-1 (PD-1) which interacts with its ligand, PD-L1 to regulate immune homeostasis. PD-1 and its ligand PD-L1 are critical in regulating T cell activation, tolerance and immuno-pathology. PD-1 is an immune checkpoint and guards against autoimmunity through two mechanisms. First, it promotes apoptosis of antigen-specific T-cells in lymph nodes. Second, it reduces apoptosis in regulatory T cells.Several types of cancer cells overexpress PD-L1 in order to escape from the PD-1/PD-L1 immuno-surveillance mechanism. Consequently PD-1 inhibitors and PD-L1 inhibitors could be used as a therapeutic in the treatment of cancers.
    Colore e forma:Powder
    Peso molecolare:1,773.8 g/mol

    Ref: 3D-CRB1000339

    1mg
    282,00€
    500µg
    206,00€
  • ACTH (18-39) Human


    Segment 18-39 of adrenocorticotropic hormone (ACTH). ACTH, also known as corticotropin, is a cleavage product from a larger precursor proopiomelanocortin (POMC). This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress. It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R). In mammals, the action of ACTH is limited to those areas of the adrenal cortex in which the glucocorticoid hormones cortisol (hydrocortisone) and corticosterone are formed. ACTH has little control over the secretion of aldosterone, the other major steroid hormone from the adrenal cortex.
    Peso molecolare:2,465.67 g/mol

    Ref: 3D-CRB1000077

    1mg
    282,00€
    500µg
    206,00€
  • Proapoptotic Peptide KLA


    Proapoptotic peptide KLA is a cationic amphipathic peptide that disrupts the mitochondrial membrane. Proapoptotic peptide KLA cannot of its own accord cross eukaryotic cell membranes and is therefore not toxic to the latter. However, KLA has been fused to various protein transduction domains (PTDs) to study its effects in cells. With the fusion of PTDs such as penetratin, KLA becomes highly toxic to cancer cells, it disrupts the mitochondrial cell membrane releasing cytochrome C. This induces cytotoxicity and triggers apoptosis while not effecting normal cells. This selectivity makes KLA-fusion peptides an ideal candidate for further research into cancer treatments as it provides targeted delivery of a highly toxic peptide that only seems to effect cancerous cells. Proapoptotic peptide KLA is provided here to research grade quality, potential PTDs are also available in our catalogue.

    Colore e forma:Powder
    Peso molecolare:1,522 g/mol

    Ref: 3D-CRB1000020

    1mg
    282,00€
    500µg
    206,00€
  • SARS-CoV-2 NSP13 (426-440)


    The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication.  NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (426-440) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.

    Peso molecolare:1,681.8 g/mol

    Ref: 3D-CRB1001816

    1mg
    282,00€
    500µg
    206,00€
  • Palmitoyl KTTKS pentapeptide


    Palmitoyl KTTKS pentapeptide.

    Peso molecolare:801.6 g/mol

    Ref: 3D-CRB1001054

    1mg
    282,00€
    500µg
    206,00€
  • SARS-CoV-2 NSP13 (466-480)


    The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication.  NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (466-480) is an epitope candidate with various predicted HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.
    Peso molecolare:1,763.9 g/mol

    Ref: 3D-CRB1001800

    1mg
    282,00€
    500µg
    206,00€
  • GLP-1 (9-36) amide

    CAS:

    Natural cleavage product of GLP-1 which, unlike GLP-1, does not affect either insulin secretion or glucose homeostasis.  GLP-1(9-36) has low affinity for, and acts as an antagonist to, the GLP-1 receptor.GLP-1 (9-36) does however display unique biological activities such as beneficial cardiovascular effects and reducing the production of reactive oxygen species (ROS). GLP-1 (9-36) also exerts important physiological effects on neuronal plasticity in the hippocampus, and inhibits chemokine-induced migration of human CD4-positive lymphocytes.GLP-1 (9-36) is formed from the breakdown of biologically active but highly unstable GLP-1 (7-36) amide by the ubiquitous serine protease, dipeptidyl peptidase-IV (DPP-IV).

    Colore e forma:Powder
    Peso molecolare:3,087.6 g/mol

    Ref: 3D-CRB1000982

    2mg
    188,00€
    5mg
    322,00€
    10mg
    471,00€
  • Ac-Arg-Gly-Lys(Ac)-AMC


    Histone deacetylases (HDACs) are a family of enzymes which are highly evolutionary conserved across all eukaryotes. HDACs modify histones by removing acetyl groups from the tail regions. Histone deacetylation is generally associated with reduced gene expression due to a more compact chromatin state less accessibility for transcription factors (TFs). HDACs are essential for many physiological processes including development and cellular homeostasis. They also play an important role in disease states, including neurodegenerative disorders, genetic diseases and cancers.This peptide is the fluorogenic substrate for assaying histone deacetylase (HDAC) activity in a two-step enzymatic reaction. The assay consists of the initial lysine deacetylation by HDAC followed by the release of the fluorescent group by trypsin. Fluorescence can be detected upon fluorophore release.
    Peso molecolare:600.3 g/mol

    Ref: 3D-CRB1101637

    1mg
    470,00€
    500µg
    282,00€
  • Tritrpticin

    CAS:
    An anti-microbial peptide (AMP) of the cathelicidin family, originally discovered in pig neutrophils. Tritrpticin has potent and broad anti-microbial activity against Gram-positive and Gram-negative bacteria, some fungi, and protozoa.Tritrpticin is thought to exist in a range of conformations in solution, and recognise its targets with high selectivity and efficiency whilst displaying low haemolytic activity. The peptides three sequential tryptophan residues flanked by two prolines and four arginines are important for the peptides interaction with membranes and for its mechanism of action. The presence of these three tryptophan and four arginines residues, also class Tritrpticin as a member of the Arg/Trp-rich family of AMPs.
    Formula:C96H132N28O14
    Peso molecolare:1,902.25 g/mol

    Ref: 3D-CRB1000021

    1mg
    282,00€
    500µg
    206,00€