Peptidi
Sottocategorie di "Peptidi"
Trovati 29708 prodotti di "Peptidi"
H-ASMTNMEL^M-OH
Peptide H-ASMTNMEL^M-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV - 1 MN ENV - 91
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,562.7 g/molH-EDVPSER^-OH
Peptide H-EDVPSER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-FYWHCLDE-OH
Peptide Ac-FYWHCLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Leu-Ile-Thr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C16H31N3O5Peso molecolare:345.43 g/molH-ALVDQVIGSR^-OH
Peptide H-ALVDQVIGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Presenilin-1 (S182 Protein) (431-467) (Human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:4,299.09 g/molH-VHLTPEEK^SAV-OH
Peptide H-VHLTPEEK^SAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-KTWGQYWQV-OH
Peptide Biot-KTWGQYWQV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Val-Glu-Ile-Asp-AMC
CAS:Ac-Val-Glu-Ile-Asp-AMC is a cell death inducer that is used to study the mechanisms of apoptosis. It has been shown to cause neuronal death in culture and also to inhibit the growth of cultured cells by inducing the activation of caspase-9, which causes protease activity. Ac-Val-Glu-Ile-Asp-AMC has been shown to induce heart function in vivo, as well as to stimulate mitochondrial membrane potential and mitochondrial cytochrome c release. This compound also induces autophagy in vitro and can affect fatty acid metabolism.Formula:C32H43N5O11Purezza:Min. 93 Area-%Colore e forma:PowderPeso molecolare:673.71 g/molCRF (human, rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C208H344N60O63S2Peso molecolare:4,758 g/molH-RV^YIHP-OH
Peptide H-RV^YIHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Gly-Ala-AMC monohydrochloride
CAS:H-Gly-Ala-AMC monohydrochloride is a chemical that is used as a reaction component or reagent in pharmaceutical and research laboratories. It has been shown to be a useful scaffold for the synthesis of complex compounds. This compound is also used as an intermediate in the synthesis of other fine chemicals. H-Gly-Ala-AMC monohydrochloride can be used as a building block for the production of versatile building blocks, which are useful for making speciality chemicals.Formula:C15H17N3O4·HClPurezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:339.77 g/molAoa-HHHHHHHHHHHHHHHHHHHH-NH2
Peptide Aoa-HHHHHHHHHHHHHHHHHHHH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SIINFEKL-cysteamide
Peptide H-SIINFEKL-cysteamide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LYDRLASTVI-NH2
Peptide Ac-LYDRLASTVI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGKGGAKRHRKVLRDNIQGIT-NTPEGBiot
Peptide H-LGKGGAKRHRKVLRDNIQGIT-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Suc-Ala-Val-Pro-Phe-pNA
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C32H40N6O9Peso molecolare:652.7 g/molγ - Fibrinogen (377 - 395), scrambled
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C100H165N25O28S2Peso molecolare:2,229.7 g/molSIVmac239 - 94
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,519.8 g/molH-AKTVKFK-MAP4
Peptide H-AKTVKFK-MAP4 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5TAMRA-AMKRHGLDNYRGYSL-NH2
Peptide 5TAMRA-AMKRHGLDNYRGYSL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NAIIK^-OH
Peptide H-NAIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 41
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,677.9 g/molLCBiot-FYWHCLDE-OH
Peptide LCBiot-FYWHCLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HSSYWYAFNNKT-NH2
Peptide H-HSSYWYAFNNKT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YFIDFVAR^-OH
Peptide H-YFIDFVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Thr-His-Leu
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C16H27N5O5Peso molecolare:369.42 g/molExendin (9-39)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C149H234N40O47SPeso molecolare:3,369.79 g/molH-TGTAEMSSILEER^-OH
Peptide H-TGTAEMSSILEER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YIQDIVASTLK^-OH
Peptide H-YIQDIVASTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AEDNADTLALVFEAPNQEK^-OH
Peptide H-AEDNADTLALVFEAPNQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YDIALVQEVR^-OH
Peptide H-YDIALVQEVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 18 (HRGDNQLQVQHTYFT)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,844 g/molH-ILAGPAGDSNVVK^-OH
Peptide H-ILAGPAGDSNVVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^DSSWSETSEASYSGL-OH
Peptide H-R^DSSWSETSEASYSGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Premelanosome Protein (PMEL) (C-Term)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolAc-KLTWQELYQLKYKGI-NH2
Peptide Ac-KLTWQELYQLKYKGI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-2Dk polyomavirus MT peptide RRLGRTLLL
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-YARAAARQARAKAL^ARQL^GVAA-OH
Peptide H-YARAAARQARAKAL^ARQL^GVAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Bz-EYY-NH2
Peptide Bz-EYY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H1 native 4-peptide mixture
H-VNSVIEK-OHH-EQLSSVSSFER-OHH-TLDYHDSNVK-OHH-ITFEATGNLVAPR-OHPeptide purity: >98%AAA: Concentration - Duplicate kit contains 100 aliquots/pack total to equal 1nmol/peptide/vial dry aliquotsH-NTTGALTTR^-OH
Peptide H-NTTGALTTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RF^-OH
Peptide H-RF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ag85B (41-61)
Please enquire for more information about Ag85B (41-61) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C73H113N19O23SPeso molecolare:1,674.87 g/molH-EIVDSYLPVILDIIK^-OH
Peptide H-EIVDSYLPVILDIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Abz-GVV-OH
Peptide Abz-GVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Phe-Ser(Psi(Me,Me)Pro)-OH
CAS:Fmoc-Phe-Ser(Psi(Me,Me)Pro)-OH is a diastereomer of Fmoc-Phe-Ser. It is used as a substrate for peptide synthesis and can be used to synthesize oxytocin receptor antagonists. It has been shown to have high affinity for the oxytocin receptor and inhibits the binding of oxytocin to the receptor by competing with it for the same site on the receptor. This inhibition leads to decreased levels of oxytocin that are responsible for uterine contractions during labour and milk ejection from the breast during breastfeeding. Fmoc-Phe-Ser(Psi(Me,Me)Pro)-OH also has been shown to be useful in filtration techniques such as chlorides, propargylamines, and divalent cyclopentenones.Formula:C30H30N2O6Purezza:90%Colore e forma:White PowderPeso molecolare:514.57 g/molH-LNALKPDNR^-OH
Peptide H-LNALKPDNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5Fam-LPYEGSLLLKLLRAPVEEV-OH
Peptide 5Fam-LPYEGSLLLKLLRAPVEEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.R5
The peptide R5 is made up of 19 amino acids and it precipitates SiO2 nanostruture silica, using its RRIL motif. It is one of the repetitive peptide sequences forming the protein silaffin sillp in Cylindrotheca fusiformis, a marine diatom.Peso molecolare:2,012.1 g/molH-ENTIYLK^-OH
Peptide H-ENTIYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TNQELQEINR^-OH
Peptide H-TNQELQEINR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-[Lys-Leu-Ala-Lys-Leu-Ala-Lys]2-Gly-Phe-Leu-Gly-(Cys-Gln-Thr-Pro-Tyr-Tyr-Met-Asn-Thr-Cys)-OH
This peptide is a cell-penetrating peptide (CPP) that is derived from the amino acid sequence of the human protein, integrin alpha 4. It binds to the α4β1 integrin receptor on the surface of cancer cells and causes apoptosis. This CPP can also be used as a target for various other biochemicals, such as chemotherapeutic agents, radionuclides, and antibodies, which can then bind to this target and induce apoptosis in cancer cells.
Formula:C142H234N36O35S3Purezza:Min. 95%Peso molecolare:3,101.86 g/molAc-Qpr-NH2
Peptide Ac-Qpr-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Synthetic SAA1 (1-76) protein (Human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:8,575.21 g/molH-QFPILLDFK^-OH
Peptide H-QFPILLDFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RLFFYRKSV^-OH
Peptide H-RLFFYRKSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Melanocyte Protein PMEL 17 (256-264)
CAS:Peptide H-YLEPGPVTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C44H67N9O14Peso molecolare:946.05 g/molH-AEDVCDLP-NH2
Peptide H-AEDVCDLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-EAQQHLLQLT-NH2
Peptide LCBiot-EAQQHLLQLT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Influenza Matrix Protein M1 (58-66)
Influenza Matrix Protein M1 (58-66) is a peptide that is derived from influenza virus peptide 58-66. It has cytotoxic effects on lymphocytes and inhibits H-Gly-Ile-Leu-Gly-Phe-Val-Phe-Thr-Leu, which is the sequence of an enzyme called CEF1. Influenza Matrix Protein M1 (58-66) is a biologically active peptide that can be used as a cancer drug or for the treatment of infectious diseases.
Formula:C49H75N9O11Purezza:Min. 95%Peso molecolare:966.2 g/molVal-Ile-Pro
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C16H29N3O4Peso molecolare:327.42 g/molH-MSSYAFFVQTCR^-OH
Peptide H-MSSYAFFVQTCR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HBV env (335 - 343)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C56H84N10O11Peso molecolare:1,073.35 g/molSIVmac239 - 40
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,775.1 g/molHXB2 gag NO-47/aa185 - 199
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,572.8 g/mol5Fam-RPKPQQFFGLM-OH
Peptide 5Fam-RPKPQQFFGLM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPLNDLFR^-OH
Peptide H-IPLNDLFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SHQESTRGRSRGRSGRSGS-NH2
Peptide Ac-SHQESTRGRSRGRSGRSGS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LILNEVSLLGSAPGGK^-OH
Peptide H-LILNEVSLLGSAPGGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVAQGVGIPEDSIFTMADR^-OH
Peptide H-VVAQGVGIPEDSIFTMADR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QIWLSSPSSGPK^^-OH
Peptide H-QIWLSSPSSGPK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HSGFEDELSEVLENQSSQAEL^K^-OH
Peptide H-HSGFEDELSEVLENQSSQAEL^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.1-Acetyl-5-bromo-6-chloro-1H-indol-3-ol
CAS:Please enquire for more information about 1-Acetyl-5-bromo-6-chloro-1H-indol-3-ol including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C10H7BrClNO2Purezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:288.52 g/molLCBiot-SYIRIADTNIT-NH2
Peptide LCBiot-SYIRIADTNIT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPGGVWAAEAISDAR^-OH
Peptide H-GPGGVWAAEAISDAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EPDLSSDIK^-OH
Peptide H-EPDLSSDIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-G^FYPSDIAVEWESNGQPESNYK^-OH
Peptide H-G^FYPSDIAVEWESNGQPESNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
pE-VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
Peptide pE-VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IESVLSSSGK^-OH
Peptide H-IESVLSSSGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-RRKDLHDDEEDEAMSITA-OH
Peptide Biot-RRKDLHDDEEDEAMSITA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAVVRTPPKSPSSAK^-OH
Peptide H-VAVVRTPPKSPSSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SUMO2 57-66
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-PKRKAEGDAC-NH2
Peptide H-PKRKAEGDAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-V^TSGSTSTSR^-OH
Peptide H-V^TSGSTSTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.GAD65 (206-220)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C86H129N15O24Peso molecolare:1,757.07 g/molH-YL^EKALNK-OH
Peptide H-YL^EKALNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-EAIYAAPFAKKK-NH2
Peptide Ac-EAIYAAPFAKKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 111
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,695 g/molH-VHPEPGTWDSFLEK^-OH
Peptide H-VHPEPGTWDSFLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-QNTFEEFPLSDIE-OH
Peptide Ac-QNTFEEFPLSDIE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Z-Val-Ala-DL-Asp-fluoromethylketone
CAS:Z-Val-Ala-DL-Asp-fluoromethylketone is a drug that is used for the treatment of cancer. It can be used in combination with other chemotherapeutic drugs, such as z-vad-fmk, to induce apoptosis in cancer cells. Z-Val-Ala-DL-Asp-fluoromethylketone also inhibits autophagy and neuronal death by inhibiting caspase activation, which prevents the release of proapoptotic proteins from mitochondria into the cytosol. This drug has been shown to have antiinflammatory effects on IL2 receptor signaling pathways and inhibits the production of proinflammatory cytokines by binding to IL2.Formula:C21H28FN3O7Purezza:Min. 95%Colore e forma:PowderPeso molecolare:453.46 g/molSubstance P acetate salt
CAS:The Substance P acetate salt is a white or off-white crystalline powder. It is soluble in ethanol and methanol, sparingly soluble in water, and insoluble in ether. The Substance P acetate salt has been widely used as a research chemical and building block for the synthesis of complex compounds. The CAS number for the substance is 137348-11-9.Formula:C63H98N18O13S·C2H4O2Purezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:1,407.68 g/molH-GGEAAEAEAEKC-NH2
Peptide H-GGEAAEAEAEKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KFRKAFKRFF-NTPEGBiot
Peptide H-KFRKAFKRFF-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GHIISLK^-OH
Peptide H-GHIISLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EFNNLER^-OH
Peptide H-EFNNLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![H-[Lys-Leu-Ala-Lys-Leu-Ala-Lys]2-Gly-Phe-Leu-Gly-(Cys-Gln-Thr-Pro-Tyr-Tyr-Met-Asn-Thr-Cys)-OH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCAN-3505-PI.webp&w=3840&q=75)
