Peptidi
Sottocategorie di "Peptidi"
Trovati 29707 prodotti di "Peptidi"
HyNic-WARYADWLFTTPLLLLDLALLV-OH
Peptide HyNic-WARYADWLFTTPLLLLDLALLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Intermedin / Adrenomedullin-2 (Human) - I-125 Labeled
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolLCBiot-TSYQVYSK-OH
Peptide LCBiot-TSYQVYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LTQLGTFEDHFLSLQR^-OH
Peptide H-LTQLGTFEDHFLSLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LTVVILEAK^-OH
Peptide H-LTVVILEAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPFLVAETPR^-OH
Peptide H-VPFLVAETPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.β-MSH (monkey)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C98H138N28O29SPeso molecolare:2,204.41 g/molH-SVILLGR^-OH
Peptide H-SVILLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GDTYPAELYITGSILR^-OH
Peptide H-GDTYPAELYITGSILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LRKLRKRLLR-OH
Peptide Ac-LRKLRKRLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
6Fam-SHLVEALYL^VCGER^G-NH2
Peptide 6Fam-SHLVEALYL^VCGER^G-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILSPFLP^LL-OH
Peptide H-ILSPFLP^LL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPPYLFT-OMe
Peptide H-LPPYLFT-OMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SmMLCKp, Smooth-Muscle Myosin Light-Chain Kinase (796-815), Calmodulin Binding
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C98H168N38O25Peso molecolare:2,278.7 g/molPAR-2 (1-6) amide (mouse, rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C29H56N10O7Peso molecolare:656.83 g/molH-SVVTVIDVFYK^-OH
Peptide H-SVVTVIDVFYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DENPVVHFFKNIVTPRTPP-NH2
Peptide H-DENPVVHFFKNIVTPRTPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ADYEK^-OH
Peptide H-ADYEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LYDRLASTVI-NH2
Peptide Ac-LYDRLASTVI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-DESDFGPLVGADS-NH2
Peptide Ac-DESDFGPLVGADS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTFELSR^-OH
Peptide H-YTFELSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HNLGHGHK^-OH
Peptide H-HNLGHGHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-89/aa353 - 367
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,492.8 g/molAc-GYDPATGTFG-NH2
Peptide Ac-GYDPATGTFG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MQQVEASLQPETLR^-OH
Peptide H-MQQVEASLQPETLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YV^GGQEHFAHLLILR^-OH
Peptide H-YV^GGQEHFAHLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGSTENLK^-OH
Peptide H-IGSTENLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVDEATIIDILTK^-OH
Peptide H-GVDEATIIDILTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SKSKDRKYTL-NH2
Peptide Ac-SKSKDRKYTL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
ADSA-CFTR
Peptide ADSA-CFTR is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALAEHGIVFGEPK^-OH
Peptide H-ALAEHGIVFGEPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DR^VYIHPF-OH
Peptide H-DR^VYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTEPISAESGEQVER^-OH
Peptide H-VTEPISAESGEQVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 33 (HHYPSAAERKHRHLP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,836.1 g/molSIVmac239 envelope - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:2,317.9 g/molH-RSLEINIDDQEQVC-NH2
Peptide H-RSLEINIDDQEQVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RIIYDRKFLMECRN-NH2
Peptide Ac-RIIYDRKFLMECRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TDSRCVIGLYHPPLQVY-NH2
Peptide H-TDSRCVIGLYHPPLQVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[Des-Arg9]-Bradykinin
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C44H61N11O10Peso molecolare:904.04 g/molH-WHLC-NH2
Peptide H-WHLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVNVSSIMSVR^-OH
Peptide H-VVNVSSIMSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CDLIKALGSPSVLP-NH2
Peptide Ac-CDLIKALGSPSVLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-LEGR^-OH
Peptide Ac-LEGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.1,3-Dipalmitoylglycerol
CAS:1,3-Dipalmitoylglycerol is a diacylglycerol, which is a type of fatty acid that is also known as a 1,2-diacylglycerol. It has been shown to exhibit hemolytic activity in the presence of hydroxyl groups. The optimum pH for 1,3-dipalmitoylglycerol is at around 7.5 and it can be used as a biocompatible polymer to form controlled-release preparations with neutral pH that are tumoricidal.Formula:C35H68O5Purezza:Min. 95%Colore e forma:PowderPeso molecolare:568.91 g/molH-F^VAPFPE-OH
Peptide H-F^VAPFPE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SPQLATLADEVSASLAKQGL-OH
Peptide Ac-SPQLATLADEVSASLAKQGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 102 (DSDEELVTTERKTPR)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,775.9 g/molH-LSQLQTYMIQFDQYIK^-OH
Peptide H-LSQLQTYMIQFDQYIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SNGPVKV^-OH
Peptide H-SNGPVKV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Met-Enkephalin-Arg-Phe
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C42H56N10O9SPeso molecolare:877.04 g/molH-IECFDSVEISGVEDR^-OH
Peptide H-IECFDSVEISGVEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLVTGLWGK^-OH
Peptide H-SLVTGLWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Mca-Pro-Leu-OH
CAS:Mca-Pro-Leu-OH is a monoclonal antibody that recognizes the antigen staphylococcus. It is useful for the diagnosis of postoperative infections, nephrology dialysis, and in renal transplantation to prevent graft rejection. It has been used as an immunofluorescent stain in human chorionic gonadotropin (hCG) and follicle stimulating hormone (FSH) studies. Mca-Pro-Leu-OH is a mouse monoclonal antibody that reacts with human chorionic gonadotropin (hCG). The specificity of this antibody has been shown to be very high since it does not react with other proteins found in nature such as follicle stimulating hormone (FSH).Formula:C23H28N2O7Purezza:Min. 95%Colore e forma:PowderPeso molecolare:444.48 g/molH-GNQWVGYDDQESVK^-OH
Peptide H-GNQWVGYDDQESVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GENFTETDVK^-OH
Peptide H-GENFTETDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FQTAAQR^-OH
Peptide H-FQTAAQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CERFLGTSEATKL-OH
Peptide Ac-CERFLGTSEATKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLYSFPEP^EA-OH
Peptide H-SLYSFPEP^EA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-SRTPSLPTPPTREPK-NH2
Peptide LCBiot-SRTPSLPTPPTREPK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RNQDQQGPFKMC-NH2
Peptide Ac-RNQDQQGPFKMC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGEIQPVSVK^-OH
Peptide H-GGEIQPVSVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EQAPNLVYMVTGNPASDEIK^-OH
Peptide H-EQAPNLVYMVTGNPASDEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.hTRT 674-683 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-SLGPALLLLQK^-OH
Peptide H-SLGPALLLLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5Tamra-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide 5Tamra-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SYFTNMFATWSPSKARLHLQ-NH2
Peptide Ac-SYFTNMFATWSPSKARLHLQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DQLIVNLLK^-OH
Peptide H-DQLIVNLLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
FS1 peptide
FS1, a synthetic BH3 peptide used in BH3 profiling, shows promise in enhancing Natural Killer (NK) cell-mediated cancer therapy. By selectively targeting anti-apoptotic BCL-2 family proteins, FS1 can trigger cytochrome c release in sensitive cancer cell lines, promoting apoptosis. This mechanism synergizes with NK cell activity, leading to increased cancer cell death both in vitro and in vivo. Therefore, FS1 represents a potential therapeutic agent for enhancing NK cell-based immunotherapy approaches.
Ac-DLIEEAASRPVDAVPEQVKAAGAY-NH2
Peptide Ac-DLIEEAASRPVDAVPEQVKAAGAY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RSGPPGLQGRLQRLLQASGNHAAGILTM-NH2
Peptide H-RSGPPGLQGRLQRLLQASGNHAAGILTM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NQNTFLR^-OH
Peptide H-NQNTFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TFDEIASGFR^-OH
Peptide H-TFDEIASGFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPGGAWAAEVISNAR^-OH
Peptide H-GPGGAWAAEVISNAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LDKNKDPLNETV-NH2
Peptide Ac-LDKNKDPLNETV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALDAAYCFR^-OH
Peptide H-ALDAAYCFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSYTQQMEDLK^-OH
Peptide H-LSYTQQMEDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-17
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,707.9 g/molH-ELAVAAAYQSVR^-OH
Peptide H-ELAVAAAYQSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NLHQPPLR^-OH
Peptide H-NLHQPPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DRV^YIHPF-OH
Peptide H-DRV^YIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CNTATCATQR^-OH
Peptide H-CNTATCATQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NYTAPGGGQFTLPGR^-OH
Peptide H-NYTAPGGGQFTLPGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ile-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Ile-2-ClTrt-Resin (200-400 mesh) 1% DVB is a resin for the synthesis of peptides. The resin is composed of the building blocks Ile, 2-chlorotrityl chloride and N,N'-Dibenzyloxycarbonyl (DBOC). It is used in the manufacture of peptides with amines, alcohols and thiols. This resin can be used in automated peptide synthesizers to produce peptides up to 400 amino acids long.Purezza:Min. 95%H-LIYDSSLCDL^-OH
Peptide H-LIYDSSLCDL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GAVDGGLSIPHSTK^-OH
Peptide H-GAVDGGLSIPHSTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CDVFSVKTEMIDQEEGIS-OH
Peptide Ac-CDVFSVKTEMIDQEEGIS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVVGAGDVGK^-OH
Peptide H-VVVGAGDVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVEPQLEDDER^-OH
Peptide H-AVEPQLEDDER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 16
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,509.8 g/molH-LITVQVVPVAAR^-OH
Peptide H-LITVQVVPVAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TFRRRLSRATR-NH2
Peptide H-TFRRRLSRATR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag #58
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,560.7 g/molCMVpp65 - 82 (QIFLEVQAIRETVEL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,788.1 g/molAc-SLKLMATLFSTYAS-OH
Peptide Ac-SLKLMATLFSTYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ADDGRPFPQVIK^-OH
Peptide H-ADDGRPFPQVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![[Des-Arg9]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50709.webp&w=3840&q=75)
