Peptidi
Sottocategorie di "Peptidi"
Trovati 29676 prodotti di "Peptidi"
Ac-SNKDRHIDSSC-NH2
Peptide Ac-SNKDRHIDSSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Glu(Glu-OH)-OH
CAS:H-Glu(Glu-OH)-OH is a synthetic amino acid that is currently being investigated as a diagnostic agent for the detection of intracellular protein degradation by matrix metalloproteinase-9 (MMP-9). H-Glu(Glu-OH)-OH is taken up by cells in a concentration and time dependent manner, with an uptake rate of approximately 1.6 x 10^6 molecules per cell per hour. The uptake mechanism is not yet known, but has been hypothesized to be due to receptor binding. H-Glu(Glu-OH)-OH binds to cerebellar granule cells and alters mitochondrial metabolism, which may be related to its effects on the ubiquitin proteasome pathway. This compound also has diagnostic potential for atherosclerosis and glutamate transport disorders.Formula:C10H16N2O7Purezza:Min. 95%Peso molecolare:276.24 g/molAc-CDLIKALGSPSVLP-NH2
Peptide Ac-CDLIKALGSPSVLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
2Adamantyl-RF-NH2
Peptide 2Adamantyl-RF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IDEALER^-OH
Peptide H-IDEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Aoa-KRRGSTCVLA-NH2
Peptide Aoa-KRRGSTCVLA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Beclin-1
The Beclin-1 peptide is derived from a region of the Beclin-1 protein, which interacts with a newly identified negative regulator of autophagy, GAPR-1 (also called GLIPR2) to act as a potent inducer of autophagy. Autophagy is an essential process that maintains cellular homeostasis and carries out lysosome-mediated degradation of unwanted proteins in the cytoplasm. It is often examined when looking at disease pathways because of this regulatory function. While the immune system initiates the removal of viruses and pathogens through the autophagic pathway, some viruses (such as HIV) are able to evade this process.Peso molecolare:2,064.22 g/molH-AKPEAPGEDASPEEL^SRYYASL^RHYL^NLVTRQRY-OH
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C190H288N54O57Peso molecolare:4,240.7 g/molH-EEQYNSTYR^-OH
Peptide H-EEQYNSTYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Met-Enkephalin-Arg-Phe
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C42H56N10O9SPeso molecolare:877.04 g/molFMRF-like neuropeptide flp-9-1
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C43H66N12O8Peso molecolare:879 g/mol(Arg8) Vasotocin
(Arg8) Vasotocin (AVT) is a member of the neurohypophyseal hormone family which contains 9 amino acids with the cysteines at positions 1 and 6 linked through a disulphide bridge. Within the central nervous system of lower vertebrates, AVT has been shown to play a role as a neuromodulator and controls reproductive behaviour. Furthermore it regulates osmotic and electrolyte balance and blood pressure within the periphery. In the mammalian brain AVT functions through arginine vasopressin (AVP) or oxytocin receptor cross-reactions. Mice have an AVT reactive receptor specific to AVT and neuropeptide S. This AVT which functions to regulate processes such as sleep and reproduction.Colore e forma:PowderPeso molecolare:1,049.5 g/molCMVpp65 - 27 (SQEPMSIYVYALPLK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,739.1 g/molAc-SVFAQ-OH
Peptide Ac-SVFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EFPFYGDYGSNYLYDN^-OH
Peptide H-EFPFYGDYGSNYLYDN^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[5-FAM] EGFR/kinKDR peptide substrate
Peptide substrate of the epidermal growth factor receptor (EGFR), a member of the receptor tyrosine kinase family known as ErbBs or HER receptors. These receptors are involved in the regulation of cell proliferation, survival, differentiation and migration. When these receptors are dysregulated many diseases, including cancer, can arise.Binding to the ligand binding domain of the EGFR causes receptor dimerization. This is sequentially followed by the tyrosine kinase domain being activated and the tyrosine residues on the C-terminal tail of the receptor becoming phosphorylated, activating downstream signalling pathways.This peptide contains an N-terminal 5-Carboxyfluorescein (5-FAM) moiety, a widely used green fluorescent tag.Peso molecolare:1,978.9 g/molAc-ASRMEEVD-OH
Peptide Ac-ASRMEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STQSAIDQI^TGK-OH
Peptide H-STQSAIDQI^TGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.M CSF Human
M-CSF is a protein that is involved in the regulation of the immune system. It is an activator of macrophages, and it also binds to receptors on cells of the immune system. It can be used as a research tool for studying how cells communicate with each other, and how certain proteins interact with each other. M-CSF is also an antibody that can bind to ion channels and other proteins. This antibody can be used for pharmacological studies to find inhibitors for specific proteins or peptides. M-CSF has been shown to have effects on many different types of cells, including lymphocytes, monocytes, neutrophils, eosinophils, basophils, and mast cells.Purezza:Min. 95%H-FPETVLAR^-OH
Peptide H-FPETVLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NVPLPVIAELPPK^-OH
Peptide H-NVPLPVIAELPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CCK octapeptide Cholecystokinin (26-33)
CAS:The octapeptide cholecystokinin (26-33), known as CCK-8, has the full biological activity of the full-length cholecystokinin (CCK). CCK acts as a hormone and neurotransmitter and is found in the GI and central nervous systems. CCK-8 is a satiety peptide that inhibits food intake.CCK-8 can also inhibit amanitin uptake into hepatocytes.Formula:C49H62N10O13S2Peso molecolare:1,063.21 g/mol(Arg)9
(Arg)9 is a cationic cell-penetrating peptide (CPP)consisting of 9 arginines. Arginine rich CPPs enter cells in a passive manner through membrane multilamellarity and fusion. Evidently as a CPP, (Arg)9 can function to deliver specific molecules to target cells and can be used for drug delivery purposes.Peso molecolare:1,423.69 g/molAc-CDGPTEIYKLTRKEAQE-OH
Peptide Ac-CDGPTEIYKLTRKEAQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVLTIDKK^-OH
Peptide H-AVLTIDKK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 8
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,845.2 g/molH-DPLAVDK^-OH
Peptide H-DPLAVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Protein Kinase C (19-36)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C93H159N35O24Peso molecolare:2,151.51 g/molH-KITDFGRAK^-OH
Peptide H-KITDFGRAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
BPC 157 trifluoroacetate
CAS:Prodotto controllatoBody Protecting Compound (BPC) 157 is a pentadecapeptide gut peptide with free radical scavenging activity. As a gastric juice pentadecapeptide fragment, BPC 157 stimulates nitric oxide synthase generation, offering significant gastric cytoprotection. It has been shown to heal lesions in experimental models of bowel disease, Unlike many other peptides, BPC 157 effectively acts without a carrier, notably aiding in muscle healing, such as in the treatment of gastrocnemius muscle complex injuries. BPC 157 is also an anti-inflammatory agent that has been shown to have clinical relevance in patients with congestive heart failure. BPC 157 has been shown to inhibit inflammation by blocking the production of proinflammatory mediators such as prostaglandins and leukotrienes. It also suppresses the production of proinflammatory cytokines such as tumor necrosis factor-α (TNF-α) and interleukin-1β (IL-1β). BPC 157 also downregulates genes that are involved in liver fibrosis, which may account for its efficacy in patients with liver cirrhosis. BPC 157 increases the production of hepatocyte growth factors (HGFs), which stimulate cell proliferation and promote tissue repair. It also upregulates genes involved in wound healing. Additionally, BPC 157 displays antianxiety and antidepressant effects. At the cellular level, it fosters proliferation, migration, and tube formation in human umbilical vein endothelial cells by activating ERK1/2 phosphorylation.
Formula:C62H98N16O22•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:1,419.53 g/molH-GTDVQAWIR^-OH
Peptide H-GTDVQAWIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALVLIAFAQYLQQCPFEDHVK^-OH
Peptide H-ALVLIAFAQYLQQCPFEDHVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myelin proteolipid peptide
PLP(178-191) corresponds to amino acids 178 to 191 of the mouse ProteoLipid Protein (PLP).Peso molecolare:1,582.7 g/molNeuropeptide Y, human, rat
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C189H285N55O57S1Peso molecolare:4,271.74 g/molH-LSQLQTYMIQFDQYIK^-OH
Peptide H-LSQLQTYMIQFDQYIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTFAQLSELHCDK^-OH
Peptide H-GTFAQLSELHCDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSDLIVLGLPWK^-OH
Peptide H-TSDLIVLGLPWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV-1 env Protein gp120 (278-292) (strains BH10, BH8, HXB2, HXB3, PV22)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C73H126N26O18Peso molecolare:1,656 g/molH-TTPPV^LDSDGSFFLYSR^-OH
Peptide H-TTPPV^LDSDGSFFLYSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IAIDLFK^-OH
Peptide H-IAIDLFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-VLQWAEKGYYTMSNN-NH2
Peptide Ac-VLQWAEKGYYTMSNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Val-Phe-Arg-Ser-Leu-Lys-AMC
Ac-Val-Phe-Arg-Ser-Leu-Lys-MCA is a peptide substrate for Site 1 Protease (S1P). Ac-Val-Phe-Arg-Ser-Leu-Lys is the sequence of amino acids that is cleaved by S1P. Acetylation of the side chain of Lys residue in the peptide substrate increases the hydrophilicity and decreases the reactivity with S1P. This product can be used to study and characterize enzymes that are involved in proteolysis, such as Site 1 Protease.Formula:C47H69N11O10Purezza:Min. 95%Peso molecolare:948.14 g/molCyc-Biot-CGKGRGLC-NH2
Peptide Cyc-Biot-CGKGRGLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,502.8 g/molH-YMEDSTYYK^-OH
Peptide H-YMEDSTYYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Suc-KGFLGK-NH2
Peptide Suc-KGFLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SRC-1 (676-700)
Steroid Receptor Coactivator - 1 (676-700).
Colore e forma:PowderPeso molecolare:2,797.4 g/molAc-SLGRKIQI-NH2
Peptide Ac-SLGRKIQI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-APGLTQALNTK^-OH
Peptide H-APGLTQALNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVVVGAGGVGK^-OH
Peptide H-LVVVGAGGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SLRRYP-NH2
Peptide Ac-SLRRYP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPGFTGGDILR^-OH
Peptide H-GPGFTGGDILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-DKFNHEAEDLFYQ-NH2
Peptide Ac-DKFNHEAEDLFYQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ile-Pro-Leu
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C17H31N3O4Peso molecolare:341.45 g/molH-SSIIHIER^-OH
Peptide H-SSIIHIER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGIENVK^-OH
Peptide H-YGIENVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-106
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,778 g/molHXB2 gag NO-116/aa461 - 475
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,663.8 g/molAnoplin
Antimicrobial and cytolytic peptide isolated from the venom of the spider wasp Anoplius samariensis. Anoplin has potent and board-spectrum antimicrobial activity against both Gram-positive and Gram-negative bacteria, antifungal properties against some plant pathogenic fungi, and no haemolytic activity against human erythrocytes. At 10 amino acids long, anoplin is the smallest naturally occurring antimicrobial and cytolytic peptide, its small size may have advantages for chemical manipulation and medical application.Peso molecolare:1,153.5 g/molSIVmac239 - 81
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,655 g/molH-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH
Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SARS-CoV-2 NSP13 (326-340)
The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication. NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (326-340) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.Peso molecolare:1,694 g/molAc-CRNLTRKTESALAKD-OH
Peptide Ac-CRNLTRKTESALAKD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVSVLTVLHQDWLNGKEY^K-OH
Peptide H-VVSVLTVLHQDWLNGKEY^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QVYSLIRPNENPAHK-OH
Peptide Ac-QVYSLIRPNENPAHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.TAT-AKAP79 (326-336) scrambled amide
The activation of transient receptor potential cation channel subfamily V member 1 (TRPV1) is believed to play a role in hyperalgesia, asthma and hypertension. TRPV1 is important for neuronal pain detection as well as the detection of heat, capsaicin, protons and the neurotransmitter anandamide.- The scaffold protein AKAP79 targets kinases to phosphorylate TRPV1, however it has been shown that inflammatory intermediates prostaglandin-E2 or bradykinin can activate these kinases creating a route for inflammation to cause hyperalgesia.This product is composed of the TRPV1 interacting residues of AKAP79 reordered into a scrambled sequence and conjugated to the cell penetrating TAT domain at the N-terminus. The scrambled peptide was shown in vivo to have no effect on TRPV1 algesia and thus is a vital control for research work. This product is a vital tool for research into suitable TRPV1 antagonists. The scrambled-TAT peptide is available for purchase in both an acid and amide form, this is the C-terminal amide form.
Peso molecolare:2,877.6 g/molH-NGFFF-NH2
Peptide H-NGFFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.TAT-CN21
TatCN21 is an inhibitor peptide for the calcium/calmodulin-dependent protein kinase II (CaMKII), a ubiquitously-expressed multifunctional serine/threonine protein kinase. TatCN21 blocks both autonomous and stimulated CaMKII activity with high selectivity. CaMKII is highly expressed in brain tissue where it regulates several processes including: neurotransmitter synthesis/release, neuronal plasticity- excitability and calcium homeostasis. Glutamate clearance by astrocytes is an essential part of normal excitatory neurotransmission, and accumulation of glutamate in the central nervous system is associated with many neurodegenerative disorders. CaMKII regulates glutamate homeostasis: CaMKII inhibition results in diminished glutamate uptake, dysregulated calcium homeostasis, release of the gliotransmitter ATP and compromise neuronal survival. Loss of CaMKII signalling may be an important factor in excitotoxicity. Peptide was obtained by linking the 11 amino acid human HIV Tat transporter to a 21 amino acid sequence corresponding to the CN21.
Colore e forma:PowderPeso molecolare:3,986.4 g/molH-R^MFPNAPYL-OH
Peptide H-R^MFPNAPYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
AH1 Sequence (6-14)
The AH1 peptide is a H2-Ld-restricted epitope derived from the sequence of the gp70 envelope protein of the ecotropic mammalian C-type retrovirus, murine leukaemia virus (MuLV, emv-1).The envelope gene products of MuLV are expressed in a variety of tumour cells, including B16 melanoma, lymphomas and leukaemia's. AH1 peptide is a tumour-associated antigen and is highly expressed on CT26 and C51 tumour cells.
Colore e forma:PowderPeso molecolare:1,126.5 g/molTAT - GluR23Y
TAT-GluR23Y is a cell penetrating peptide that inhibits phosphorylation of AMPA receptor endocytosis.Recent studies have shown that AMPA receptor endocytosis, which is a cellular mechanism underlying the formation of LTD, plays a critical role in facilitating initial extinction of learned fear. Tat-Glur23Y can block regulated AMPA and thereby prevents long-term depression (LTD) in structures such as the nucleus accumbens and dorsal hippocampus.Peso molecolare:2,632.4 g/molH-IKGEHPGLSIGDVAK^-OH
Peptide H-IKGEHPGLSIGDVAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FGESEQIIVTR^-OH
Peptide H-FGESEQIIVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-36/aa141 - 155
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,752 g/molH-TAFQEALDAAGDK^-OH
Peptide H-TAFQEALDAAGDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NSSVSGIFTFQK^-OH
Peptide H-NSSVSGIFTFQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^PKPQQFFGLM-OH
Peptide H-R^PKPQQFFGLM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
L17E
CAS:L17E is an endosomolytic peptide derived from the cationic and membrane-lytic spider venom peptide M-lycotoxin and contains a substitution of leucine by glutamic acid at position 17. L17E is able to promote the endocytic uptake and cytosolic delivery of exosome-encapsulated proteins.A major obstacles to intracellular targeting by antibodies is the limited release of the antibodies into the cytosol, once inside endosomes. L17E can achieve an enhanced cellular uptake via the induction of micropinocytosis. Once inside the endosome, positively charged L17E is able to preferentially disrupt negatively charged endosomal membranes to enable a marked cytosolic liberation of antibodies (immunoglobulins G (IgGs)) from endosomes.L17E had little pH dependence and no enhanced helical structure is needed for L17E-mediated membrane lysis.Formula:C134H219N37O32Colore e forma:PowderPeso molecolare:2,857.7 g/molH-EVPLNTIIFMGR^-OH
Peptide H-EVPLNTIIFMGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGGIGTVPVGR^-OH
Peptide H-IGGIGTVPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Azhx-Penetratin
Identification of cell penetrating conjugates has aided numerous areas of scientific development. The Drosophila transcription factor Antennapedia contains a homeodomain that can be internalised by cells to the cytoplasm and to the nucleus in a receptor-independent mechanism. The key residues for internalisation have been sequenced (RQIKIWFQNRRMKWKK), named penetratin, and used in several studies to aid entry of fusion proteins into cells.The full 60 amino acid homeodomain was fused to a T cell epitope of the influenza nucleoprotein and successfully internalised into T cells for presentation. The fragment known as penetratin was fused to a ligand for Grb-2 resulting in inhibition of downstream Grb-2 signalling events.- Penetratin has also been used in vivo to prime cytotoxic T lymphocytes by conjugating short antigenic peptides to the CPP. This penetratin has been synthesised with an N-terminal 6-azidohexanoic acid (Azhx) which can be used for various applications as a linker.Colore e forma:PowderPeso molecolare:2,384.4 g/molProstatic Acid Phosphatase (248 - 286), PAP (248 - 286)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C203H342N60O54S2Peso molecolare:4,551.5 g/molH-ASTIEMPQQAR^-OH
Peptide H-ASTIEMPQQAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HSVVVPYEPPEAGSEYTTIHYK^-OH
Peptide H-HSVVVPYEPPEAGSEYTTIHYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Click Arg9
Cell penetrating peptides (CPP) are a keen area of molecule design to create the ideal vector for transporting macromolecule cargo into the cell. There is also a crossover of CPP acting as antimicrobial peptides (AMP) due to their ability to permeabilise the lipid membrane. AMPs are now being considered as a tool against the rise of antibiotic-resistant bacteria. CPPs and AMPS tend to be 10 - 30 amino acids long, cationic, and rich in arginine (R) and tryptophan (W). The presence of R and W in the backbone have been used to generate de novo CPP/AMP peptides with improved functions. Of these, nonarginine (R9) was shown to have the highest cellular uptake against other CPPs tested, lowest cytotoxicity and significant antimicrobial activity.R9 is provided here with a N-terminal alkyne attachment. Two of the most regularly encountered functional groups for click chemistry are azides and alkynes, and the azide-alkyne cycloaddition has become the most popular click reaction. The use of click chemistry with alkyne-R9 allows a wide variety of applications and has already been used for conjugation, modification and peptide design.
Colore e forma:PowderPeso molecolare:1,502 g/molH-LLVYTILPDGEVVGDSAK^-OH
Peptide H-LLVYTILPDGEVVGDSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSALFYQK^-OH
Peptide H-SSALFYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SAEGLDASASLR^-OH
Peptide H-SAEGLDASASLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Atorvastatin acid
CAS:Atorvastatin acid is a pharmaceutical compound belonging to the class of statins, which is a synthetic derivative of fungal metabolites. It functions as an HMG-CoA reductase inhibitor, playing a critical role in the cholesterol biosynthesis pathway. By inhibiting this key enzyme, atorvastatin acid effectively reduces the conversion of HMG-CoA to mevalonate, a precursor of cholesterol, thus lowering overall cholesterol levels in the bloodstream.Formula:C33H35FN2O5Purezza:Min. 98 Area-%Colore e forma:White PowderPeso molecolare:558.64 g/molTat-NR2Bct
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C105H188N42O30Peso molecolare:2,518.9 g/molH-EDSQCVIGLYQPPLQVY-NH2
Peptide H-EDSQCVIGLYQPPLQVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-D-Leu-Wang Resin (100-200 mesh) 1% DVB
Fmoc-D-Leu-Wang Resin (100-200 mesh) is a research tool that is an activator, ligand, and receptor. It is used in the study of cell biology, antibody production, ion channels, and protein interactions. Fmoc-D-Leu-Wang Resin (100-200 mesh) can be used to make peptides or as a pharmacological inhibitor. This product is high purity and has CAS No.Purezza:Min. 95%H-EFSEV^EGR-OH
Peptide H-EFSEV^EGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASGPGGGAPR^-OH
Peptide H-ASGPGGGAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-G^P-OH
Peptide H-G^P-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RLR-[AMC] Proteasome Substrate
Fluorogenic substrate peptide to assay trypsin-like activity. In its intact state this peptide is non-fluorescent, however when aminomethylcoumarin (AMC) is released upon hydrolysation, fluorescence can be detected. This peptide is therefore a useful tool for analysing trypsin-like enzyme activity.AMC is a fluorescent dye with excitation maxima at around 360 nm and emission maxima at around 450 nm. AMC can be excited with a mercury lamp and observed using a UV filter set.Peso molecolare:642.4 g/molLCBiot-KPVSKMRMATPLLMQAL-OH
Peptide LCBiot-KPVSKMRMATPLLMQAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILGFVFTL^T-OH
Peptide H-ILGFVFTL^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Tirzepatide sodium
CAS:Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.
Formula:C225H348N48O68•xNaPurezza:Min. 95 Area-%Colore e forma:Powder
![[5-FAM] EGFR/kinKDR peptide substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1101428.webp&w=3840&q=75)
![Ac-RLR-[AMC] Proteasome Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1100438.webp&w=3840&q=75)
