Peptidi
Sottocategorie di "Peptidi"
Trovati 29635 prodotti di "Peptidi"
α-Bag Cell Peptide (1-7)
Catalogue peptide; min. 95% purity
Formula:C44H67N13O9Peso molecolare:922.11 g/molRef: 3D-VAC-00244
Prodotto fuori produzioneFmoc-Phe-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Ref: 3D-FF111733
Prodotto fuori produzioneCys-Gly-Lys-Lys-Gly-Amyloid beta-Protein (36-42)
Catalogue peptide; min. 95% purity
Formula:C47H85N14O13SPeso molecolare:1,087.35 g/molRef: 3D-VAC-00274
Prodotto fuori produzionebeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Formula:C23H28N4O4Peso molecolare:424.50 g/molRef: 3D-VAC-00901
Prodotto fuori produzioneBiotin-Galanin, human
Catalogue peptide; min. 95% purity
Formula:C149H224N44O45SPeso molecolare:3,383.78 g/molRef: 3D-VAC-00093
Prodotto fuori produzioneRef: 3D-VAC-00353
Prodotto fuori produzioneTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Formula:C69H122N26O22Peso molecolare:1,667.90 g/molRef: 3D-VAC-00681
Prodotto fuori produzionerec IFN-gamma (human)
CAS:Prodotto controllatoPlease enquire for more information about rec IFN-gamma (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Biotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Formula:C107H140N22O34S2Peso molecolare:2,342.56 g/molRef: 3D-VAC-00088
Prodotto fuori produzioneIntermedin (human)
Catalogue peptide; min. 95% purity
Formula:C219H351N69O66S3Peso molecolare:5,102.84 g/molRef: 3D-VAC-00769
Prodotto fuori produzioneBiotin-LC-Neurogranin (28-43)
Catalogue peptide; min. 95% purity
Formula:C94H159N31O20S2Peso molecolare:2,139.48 g/molRef: 3D-VAC-00065
Prodotto fuori produzioneParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Formula:C151H211N37O39SPeso molecolare:3,199.65 g/molRef: 3D-VAC-00276
Prodotto fuori produzioneCorticostatin, human
Catalogue peptide; min. 95% purity
Formula:C157H261N49O43S6Peso molecolare:3,715.47 g/molRef: 3D-VAC-00788
Prodotto fuori produzione[D-Phe7] a-MSH, amide
Catalogue peptide; min. 95% purity
Formula:C77H109N21O19SPeso molecolare:1,664.92 g/molRef: 3D-VAC-00051
Prodotto fuori produzioneRef: 3D-VAC-00194
Prodotto fuori produzione[Met2]-Deltorphin
Catalogue peptide; min. 95% purity
Formula:C44H62N10O10S2Peso molecolare:955.17 g/molRef: 3D-VAC-00898
Prodotto fuori produzioneBoc-D-His(Boc)-OH benzene solvate
CAS:Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C16H25N3O6Purezza:Min. 95%Colore e forma:SolidPeso molecolare:355.39 g/molRef: 3D-FB111250
Prodotto fuori produzioneAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formula:C264H406N80O77S3Peso molecolare:6,028.72 g/molRef: 3D-VAC-00919
Prodotto fuori produzioneBoc-D-Glu-OEt·DCHA
CAS:Prodotto controllatoPlease enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C12H21NO6·C12H23NPurezza:Min. 95%Peso molecolare:456.62 g/molRef: 3D-FB111281
Prodotto fuori produzioneH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP47266
Prodotto fuori produzioneRef: 3D-VAC-00639
Prodotto fuori produzioneHIV-gp41-Antigenic Peptide 5
Catalogue peptide; min. 95% purity
Formula:C184H282N56O53S2Peso molecolare:4,190.77 g/molRef: 3D-VAC-00698
Prodotto fuori produzionePalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS:Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Formula:C54H103NO7SPurezza:Min. 95%Peso molecolare:910.46 g/molRef: 3D-FP107899
Prodotto fuori produzione[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Formula:C104H159N29O31Peso molecolare:2,311.60 g/molRef: 3D-VAC-00893
Prodotto fuori produzioneDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Formula:C35H60N12O7Peso molecolare:760.94 g/molRef: 3D-VAC-00411
Prodotto fuori produzioneProinsulin C-peptide (55-89), human
Catalogue peptide; min. 95% purity
Formula:C153H259N49O52Peso molecolare:3,616.98 g/molRef: 3D-VAC-00682
Prodotto fuori produzioneRef: 3D-VAC-00717
Prodotto fuori produzione[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Formula:C189H285N55O57SPeso molecolare:4,271.67 g/molRef: 3D-VAC-00911
Prodotto fuori produzioneDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Formula:C60H105N21O12Peso molecolare:1,312.64 g/molRef: 3D-VAC-00419
Prodotto fuori produzioneGAD65 (78-97)
Catalogue peptide; min. 95% purity
Formula:C97H148N26O29S2Peso molecolare:2,206.53 g/molRef: 3D-VAC-00543
Prodotto fuori produzioneAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:855 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Peso molecolare:966.18 g/molRef: 3D-PP48052
Prodotto fuori produzioneCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purezza:Min. 95%Peso molecolare:2,088.86 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SPeso molecolare:1,079.27 g/molRef: 3D-PP42775
Prodotto fuori produzioneCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purezza:Min. 95%Peso molecolare:1,287.65 g/mol
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
![[Met2]-Deltorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00898.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
