Peptidi
Sottocategorie di "Peptidi"
Trovati 29780 prodotti di "Peptidi"
[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin
Catalogue peptide; min. 95% purity
Formula:C60H87N19O14Peso molecolare:1,298.48 g/molRef: 3D-VAC-00152
Prodotto fuori produzioneNps-Val-OH·DCHA
CAS:Prodotto controllatoPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C11H14N2O4S·C12H23NPurezza:Min. 95%Peso molecolare:451.62 g/molRef: 3D-FN107891
Prodotto fuori produzioneGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SPeso molecolare:5,040.74 g/molRef: 3D-VAC-00849
Prodotto fuori produzioneBoc-D-Glu-OEt·DCHA
CAS:Prodotto controllatoPlease enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C12H21NO6·C12H23NPurezza:Min. 95%Peso molecolare:456.62 g/molRef: 3D-FB111281
Prodotto fuori produzioneSH2 Domain Ligand (4)
Catalogue peptide; min. 95% purity
Formula:C40H51N5O18P2Peso molecolare:951.86 g/molRef: 3D-VAC-00020
Prodotto fuori produzione[Asn76] PTH (64-84), human
Catalogue peptide; min. 95% purity
Formula:C94H163N27O35Peso molecolare:2,231.51 g/molRef: 3D-VAC-00372
Prodotto fuori produzioneMelanotan II, MT-Ⅱ
Catalogue peptide; min. 95% purity
Formula:C50H69N15O9Peso molecolare:1,024.2 g/molRef: 3D-VAC-00018
Prodotto fuori produzioneHuman CMV Assemblin Protease Substrate (M-site)
Catalogue peptide; min. 95% purity
Formula:C52H96N20O16Peso molecolare:1,257.47 g/molRef: 3D-VAC-00665
Prodotto fuori produzioneRef: 3D-VAC-00339
Prodotto fuori produzioneDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formula:C66H117N23O13Peso molecolare:1,440.81 g/molRef: 3D-VAC-00416
Prodotto fuori produzione[Arg3] Substance P
Catalogue peptide; min. 95% purity
Formula:C63H98N20O13SPeso molecolare:1,375.67 g/molRef: 3D-VAC-00678
Prodotto fuori produzioneα-Conotoxin IMI
Catalogue peptide; min. 95% purity
Formula:C52H74N20O15S4Peso molecolare:1,347.58 g/molRef: 3D-VAC-00405
Prodotto fuori produzione[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
Catalogue peptide; min. 95% purity
Formula:C157H253N53O42Peso molecolare:3,555.01 g/molRef: 3D-VAC-00488
Prodotto fuori produzioneRef: 3D-VAC-00171
Prodotto fuori produzione[Val5,Asn9]-Angiotensin I
Catalogue peptide; min. 95% purity
Formula:C59H86N16O15Peso molecolare:1,259.44 g/molRef: 3D-VAC-00346
Prodotto fuori produzioneC-terminal Proghrelin Isoform Peptide, mouse
Catalogue peptide; min. 95% purity
Formula:C50H86N22O17Peso molecolare:1,267.38 g/molRef: 3D-VAC-00689
Prodotto fuori produzioneBiotinyl-MCH (salmon)
Catalogue peptide; min. 95% purity
Formula:C99H153N29O26S5Peso molecolare:2,325.82 g/molRef: 3D-VAC-00086
Prodotto fuori produzioneRef: 3D-VAC-00563
Prodotto fuori produzioneInfluenza HA (529-537)
Catalogue peptide; min. 95% purity
Formula:C41H67N9O13Peso molecolare:894.04 g/molRef: 3D-VAC-00515
Prodotto fuori produzioneTGF α(34-43) (rat)
Catalogue peptide; min. 95% purity
Formula:C44H67N15O13S2Peso molecolare:1,078.25 g/molRef: 3D-VAC-00277
Prodotto fuori produzioneInsulin Receptor (1142-1153)
Catalogue peptide; min. 95% purity
Formula:C72H107N19O24Peso molecolare:1,622.77 g/molRef: 3D-VAC-00774
Prodotto fuori produzioneMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS:Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.
Formula:C118H177N35O29S•C2HO2F3Purezza:Min. 95%Colore e forma:PowderPeso molecolare:2,695.98 g/molRef: 3D-FM109206
Prodotto fuori produzione[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formula:C216H343N67O60Peso molecolare:4,838.43 g/molRef: 3D-VAC-00857
Prodotto fuori produzionegp100 (178-187)
Catalogue peptide; min. 95% purity
Formula:C42H71N11O14S2Peso molecolare:1,018.23 g/molRef: 3D-VAC-00605
Prodotto fuori produzioneCEA Related, TYACFVSNL
Catalogue peptide; min. 95% purity
Formula:C46H68N10O14SPeso molecolare:1,017.17 g/molRef: 3D-VAC-00783
Prodotto fuori produzioneRef: 3D-VAC-00358
Prodotto fuori produzione[Ile34]-beta-Amyloid (25-34)
Catalogue peptide; min. 95% purity
Formula:C40H72N12O13Peso molecolare:929.09 g/molRef: 3D-VAC-00451
Prodotto fuori produzioneTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Formula:C79H120N18O21Peso molecolare:1,657.95 g/molRef: 3D-VAC-00651
Prodotto fuori produzioneγ-TAC4 (30-61)-NH2
Catalogue peptide; min. 95% purity
Formula:C155H242N40O49SPeso molecolare:3,481.96 g/molRef: 3D-VAC-00760
Prodotto fuori produzionebeta-Amyloid (1-11)
Catalogue peptide; min. 95% purity
Formula:C56H76N16O22Peso molecolare:1,325.32 g/molRef: 3D-VAC-00308
Prodotto fuori produzioneP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Formula:C33H45N6O12PPeso molecolare:748.8 g/molRef: 3D-VAC-00034
Prodotto fuori produzione[Phe22] Big Endothelin-1 (19-37), human
Catalogue peptide; min. 95% purity
Formula:C104H152N26O26Peso molecolare:2,182.53 g/molRef: 3D-VAC-00505
Prodotto fuori produzionebeta-Amyloid/A4 Protein Precusor (APP) (319-335)
Catalogue peptide; min. 95% purity
Formula:C86H151N31O26S2Peso molecolare:2,099.48 g/molRef: 3D-VAC-00226
Prodotto fuori produzioneCC Chemokine Receptor 3 Fragment II, amide
Catalogue peptide; min. 95% purity
Formula:C114H175N25O42S2Peso molecolare:2,631.93 g/molRef: 3D-VAC-00613
Prodotto fuori produzionePrepro TRH (53-74)
Catalogue peptide; min. 95% purity
Formula:C118H182N32O32Peso molecolare:2,560.96 g/molRef: 3D-VAC-00393
Prodotto fuori produzioneRef: 3D-VAC-00385
Prodotto fuori produzione[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Formula:C59H89N17O14Peso molecolare:1,260.47 g/molRef: 3D-VAC-00511
Prodotto fuori produzioneRef: 3D-VAC-00718
Prodotto fuori produzioneBiotin-Neuromedin S (rat)
Catalogue peptide; min. 95% purity
Formula:C67H87N15O14Peso molecolare:1,326.53 g/molRef: 3D-VAC-00102
Prodotto fuori produzioneRef: 3D-VAC-00673
Prodotto fuori produzioneGAD65 (78-97)
Catalogue peptide; min. 95% purity
Formula:C97H148N26O29S2Peso molecolare:2,206.53 g/molRef: 3D-VAC-00543
Prodotto fuori produzione[Tyr1]-pTH (1-34) (rat)
Catalogue peptide; min. 95% purity
Formula:C186H295N55O49S2Peso molecolare:4,149.86 g/molRef: 3D-VAC-00930
Prodotto fuori produzione[Gln11]-beta-Amyloid (1-40)
Catalogue peptide; min. 95% purity
Formula:C194H296N54O57SPeso molecolare:4,328.91 g/molRef: 3D-VAC-00314
Prodotto fuori produzioneCrustacean Erythrophore Concentrating Hormone
Catalogue peptide; min. 95% purity
Formula:C45H59N11O11Peso molecolare:930.04 g/molRef: 3D-VAC-00190
Prodotto fuori produzioneRef: 3D-VAC-00183
Prodotto fuori produzioneBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Formula:C72H122N21O29SPeso molecolare:1,777.92 g/molRef: 3D-VAC-00122
Prodotto fuori produzioneAc-Adhesin (1025-1044) amide
Catalogue peptide; min. 95% purity
Formula:C97H160N26O32Peso molecolare:2,202.51 g/molRef: 3D-VAC-00042
Prodotto fuori produzionePrésure. 10. 145-148
Catalogue peptide; min. 95% purity
Formula:C46H59N7O12Peso molecolare:902.02 g/molRef: 3D-VAC-00263
Prodotto fuori produzioneBiotin-Glucagon (1-29), bovine, human, porcine
Catalogue peptide; min. 95% purity
Formula:C163H239N45O51S2Peso molecolare:3,709.03 g/molRef: 3D-VAC-00100
Prodotto fuori produzioneBAD (103-127), human
Catalogue peptide; min. 95% purity
Formula:C137H212N42O39SPeso molecolare:3,103.54 g/molRef: 3D-VAC-00617
Prodotto fuori produzioneFMRF-related peptide, SDPFLRF-NH2
Catalogue peptide; min. 95% purity
Formula:C42H61N11O10Peso molecolare:880.02 g/molRef: 3D-VAC-00707
Prodotto fuori produzionePannexin-1 Fragment (4515)
Catalogue peptide; min. 95% purity
Formula:C59H104N22O20Peso molecolare:1,441.62 g/molRef: 3D-VAC-00371
Prodotto fuori produzioneVasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Formula:C116H161N27O32S4Peso molecolare:2,573.99 g/molRef: 3D-VAC-00288
Prodotto fuori produzioneRef: 3D-VAC-00439
Prodotto fuori produzione(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C59H84N18O14Purezza:Min. 95%Peso molecolare:1,269.41 g/molRef: 3D-FS109491
Prodotto fuori produzioneH-Asp-NH2
CAS:H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.
Formula:C4H8N2O3Purezza:Min. 95%Peso molecolare:132.12 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
Catalogue peptide; min. 95% purity
Formula:C62H97N21O16S1Peso molecolare:1,424.66 g/molRef: 3D-VAC-00878
Prodotto fuori produzioneNES Topoisomerase II alpha (1017-1028)
Catalogue peptide; min. 95% purity
Formula:C73H117N19O19Peso molecolare:1,564.86 g/molRef: 3D-VAC-00329
Prodotto fuori produzioneRef: 3D-VAC-00194
Prodotto fuori produzioneKGF Receptor Peptide
Catalogue peptide; min. 95% purity
Formula:C114H174N30O42SPeso molecolare:2,668.90 g/molRef: 3D-VAC-00491
Prodotto fuori produzioneTNF-α(71-82), human
Catalogue peptide; min. 95% purity
Formula:C51H91N19O18Peso molecolare:1,258.41 g/molRef: 3D-VAC-00735
Prodotto fuori produzione[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Formula:C145H210N42O45Peso molecolare:3,261.54 g/molRef: 3D-VAC-00315
Prodotto fuori produzioneRef: 3D-VAC-00727
Prodotto fuori produzioneGnT-V (nt38-67)
Catalogue peptide; min. 95% purity
Formula:C54H89N13O13SPeso molecolare:1,159.45 g/molRef: 3D-VAC-00803
Prodotto fuori produzioneDok-4 (263-275)
Catalogue peptide; min. 95% purity
Formula:C70H101N21O18Peso molecolare:1,524.72 g/molRef: 3D-VAC-00577
Prodotto fuori produzione(D-Ala2)-GRF (1-29) amide (human)
CAS:Please enquire for more information about (D-Ala2)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C149H246N44O42SPurezza:Min. 95%Peso molecolare:3,357.88 g/molRef: 3D-FA109070
Prodotto fuori produzioneMARCKS Substrate (151-175)
Catalogue peptide; min. 95% purity
Formula:C147H246N41O40P3Peso molecolare:3,320.78 g/molRef: 3D-VAC-00525
Prodotto fuori produzioneBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
Catalogue peptide; min. 95% purity
Formula:C107H141N22O37PS2Peso molecolare:2,422.53 g/molRef: 3D-VAC-00087
Prodotto fuori produzioneMAP Kinase Substrate
Catalogue peptide; min. 95% purity
Formula:C101H172N30O32Peso molecolare:2,318.66 g/molRef: 3D-VAC-00546
Prodotto fuori produzioneHistone H3 (116-136), N15-39
Catalogue peptide; min. 95% purity
Formula:C112H197N39O30Peso molecolare:2,570 g/molRef: 3D-VAC-00241
Prodotto fuori produzioneAngiotensin II Receptor, AT2, Amino Terminal Fragment
Catalogue peptide; min. 95% purity
Formula:C79H125N23O28SPeso molecolare:1,877.08 g/molRef: 3D-VAC-00602
Prodotto fuori produzione[Ile12, Val15] MUC5AC Analog 3
Catalogue peptide; min. 95% purity
Formula:C67H112N16O25Peso molecolare:1,541.73 g/molRef: 3D-VAC-00456
Prodotto fuori produzione[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Formula:C49H81N21O17Peso molecolare:1,236.32 g/molRef: 3D-VAC-00021
Prodotto fuori produzioneDynorphin A (3-13), porcine
Catalogue peptide; min. 95% purity
Formula:C64H114N22O12Peso molecolare:1,383.76 g/molRef: 3D-VAC-00412
Prodotto fuori produzione[D-Phe7] a-MSH, amide
Catalogue peptide; min. 95% purity
Formula:C77H109N21O19SPeso molecolare:1,664.92 g/molRef: 3D-VAC-00051
Prodotto fuori produzioneH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SPeso molecolare:1,079.27 g/molRef: 3D-PP42775
Prodotto fuori produzioneH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Peso molecolare:966.18 g/molRef: 3D-PP48052
Prodotto fuori produzioneAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:855 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purezza:Min. 95%Peso molecolare:2,088.86 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purezza:Min. 95%Peso molecolare:1,287.65 g/mol
![[D-Arg0,Hyp2,3,D-Phe7]-Bradykinin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00152.webp&w=3840&q=75)
![[Asn76] PTH (64-84), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00372.webp&w=3840&q=75)
![[Arg3] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00678.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00488.webp&w=3840&q=75)
![[Glu2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00171.webp&w=3840&q=75)
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![[Ile34]-beta-Amyloid (25-34)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00451.webp&w=3840&q=75)
![[Phe22] Big Endothelin-1 (19-37), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00505.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[Cys3, 6, Tyr8, Pro10]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00673.webp&w=3840&q=75)
![[Tyr1]-pTH (1-34) (rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00930.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00314.webp&w=3840&q=75)
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
![[Ile12, Val15] MUC5AC Analog 3](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00456.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
