Peptidi
Sottocategorie di "Peptidi"
Trovati 29639 prodotti di "Peptidi"
Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt
CAS:Please enquire for more information about Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C50H63N15O13Purezza:Min. 95%Peso molecolare:1,082.13 g/molRef: 3D-FA110993
Prodotto fuori produzione[D-Ala2,Leu5,Arg6] Enkephalin
Catalogue peptide; min. 95% purity
Formula:C35H51N9O8Peso molecolare:725.85 g/molRef: 3D-VAC-00837
Prodotto fuori produzioneRef: 3D-VAC-00560
Prodotto fuori produzione[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Formula:C49H81N21O17Peso molecolare:1,236.32 g/molRef: 3D-VAC-00021
Prodotto fuori produzioneFluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C41H43FN4O14Purezza:Min. 95%Peso molecolare:834.8 g/molGnT-V (nt38-67)
Catalogue peptide; min. 95% purity
Formula:C54H89N13O13SPeso molecolare:1,159.45 g/molRef: 3D-VAC-00803
Prodotto fuori produzione[Pro34]-Neuropeptide Y, human, rat
Catalogue peptide; min. 95% purity
Formula:C189H285N55O57SPeso molecolare:4,271.67 g/molRef: 3D-VAC-00912
Prodotto fuori produzioneBiotin-Neuromedin S (rat)
Catalogue peptide; min. 95% purity
Formula:C67H87N15O14Peso molecolare:1,326.53 g/molRef: 3D-VAC-00102
Prodotto fuori produzioneFMRF-related peptide, Lymnaea heptapeptide
Catalogue peptide; min. 95% purity
Formula:C41H59N11O9Peso molecolare:850.00 g/molRef: 3D-VAC-00408
Prodotto fuori produzioneDisulfide biotin azide
CAS:Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.Formula:C27H48N8O7S3Purezza:Min 95%Peso molecolare:692.92 g/molRef: 3D-CRB7108314
Prodotto fuori produzioneRef: 3D-VAC-00530
Prodotto fuori produzionebeta-Amyloid (10-35)
Catalogue peptide; min. 95% purity
Formula:C133H204N34O37SPeso molecolare:2,903.38 g/molRef: 3D-VAC-00863
Prodotto fuori produzioneTyr-Leptin (26-39) (human)
CAS:Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C80H137N19O25Purezza:Min. 95%Peso molecolare:1,765.06 g/molRef: 3D-FT109022
Prodotto fuori produzioneα-Bag Cell Peptide (1-7)
Catalogue peptide; min. 95% purity
Formula:C44H67N13O9Peso molecolare:922.11 g/molRef: 3D-VAC-00244
Prodotto fuori produzionepp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
Catalogue peptide; min. 95% purity
Formula:C66H109N23O23Peso molecolare:1,592.74 g/molRef: 3D-VAC-00687
Prodotto fuori produzione[Ile34]-beta-Amyloid (25-34)
Catalogue peptide; min. 95% purity
Formula:C40H72N12O13Peso molecolare:929.09 g/molRef: 3D-VAC-00451
Prodotto fuori produzionePannexin-1 Fragment (4515)
Catalogue peptide; min. 95% purity
Formula:C59H104N22O20Peso molecolare:1,441.62 g/molRef: 3D-VAC-00371
Prodotto fuori produzioneFluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C45H47FN6O14Purezza:Min. 95%Peso molecolare:914.89 g/molGAD65 (78-97)
Catalogue peptide; min. 95% purity
Formula:C97H148N26O29S2Peso molecolare:2,206.53 g/molRef: 3D-VAC-00543
Prodotto fuori produzioneAdrenomedullin (1-52), porcine
Catalogue peptide; min. 95% purity
Formula:C262H403N79O76S3Peso molecolare:5,971.67 g/molRef: 3D-VAC-00918
Prodotto fuori produzioneCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Formula:C124H205N39O39S2Peso molecolare:2,930.38 g/molRef: 3D-VAC-00514
Prodotto fuori produzione[Tyr8,Nle11] Substance P
Catalogue peptide; min. 95% purity
Formula:C64H100N18O14Peso molecolare:1,345.62 g/molRef: 3D-VAC-00677
Prodotto fuori produzione[D-Pro194]-IL-1 beta (193-195) (human)
Catalogue peptide; min. 95% purity
Formula:C15H28N4O5Peso molecolare:344.41 g/molRef: 3D-VAC-00516
Prodotto fuori produzioneCrustacean Erythrophore Concentrating Hormone
Catalogue peptide; min. 95% purity
Formula:C45H59N11O11Peso molecolare:930.04 g/molRef: 3D-VAC-00190
Prodotto fuori produzioneBiotin-Neurokinin B
Catalogue peptide; min. 95% purity
Formula:C67H87N15O14Peso molecolare:1,326.53 g/molRef: 3D-VAC-00082
Prodotto fuori produzioneRef: 3D-VAC-00673
Prodotto fuori produzioneP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Formula:C33H45N6O12PPeso molecolare:748.8 g/molRef: 3D-VAC-00034
Prodotto fuori produzioneRef: 3D-VAC-00358
Prodotto fuori produzioneRef: 3D-VAC-00465
Prodotto fuori produzioneH-D-Phe-pip-Arg-pna acetate
CAS:H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Formula:C27H36N8O5Purezza:Min. 95%Peso molecolare:552.6 g/molZ-Ile-Trp-OH
CAS:Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C25H29N3O5Purezza:Min. 95%Peso molecolare:451.51 g/molRef: 3D-FI111493
Prodotto fuori produzioneProinsulin C-peptide (55-89), human
Catalogue peptide; min. 95% purity
Formula:C153H259N49O52Peso molecolare:3,616.98 g/molRef: 3D-VAC-00682
Prodotto fuori produzioneGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SPeso molecolare:5,040.74 g/molRef: 3D-VAC-00849
Prodotto fuori produzioneH-Thr-Asp-OH TFA salt
CAS:Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C8H14N2O6C2F3HO2Purezza:Min. 95%Peso molecolare:348.23 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:855 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purezza:Min. 95%Peso molecolare:2,088.86 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Peso molecolare:966.18 g/molRef: 3D-PP48052
Prodotto fuori produzioneH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SPeso molecolare:1,079.27 g/molRef: 3D-PP42775
Prodotto fuori produzioneCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purezza:Min. 95%Peso molecolare:1,287.65 g/mol
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Pro34]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00912.webp&w=3840&q=75)
![[Ile34]-beta-Amyloid (25-34)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00451.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[Cys3, 6, Tyr8, Pro10]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00673.webp&w=3840&q=75)
