Peptidi
Sottocategorie di "Peptidi"
Trovati 29598 prodotti di "Peptidi"
H-SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR-OH
Peptide H-SDYLNNNPLFPRYDIGNVELSTAYRSFANQKAPGRLNQNWALTADYTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EQQWNFAGIEAAASA-OH
Peptide H-EQQWNFAGIEAAASA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QGYYPTSPQ-OH
Peptide H-QGYYPTSPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLPMSPR-OH
Peptide H-DLPMSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WIPYFGPAAEGIYTE-OH
Peptide H-WIPYFGPAAEGIYTE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HISAENTK-OH
Peptide H-HISAENTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LMLIWYRPV-OH
Peptide H-LMLIWYRPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPMTYKAAVDLSHFL-OH
Peptide H-RPMTYKAAVDLSHFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVTCTYSPALNK-OH
Peptide H-SVTCTYSPALNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DENPVVHFFKNIVTPRTPP-OH
Peptide H-DENPVVHFFKNIVTPRTPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GYLQPRTFL-OH
Peptide H-GYLQPRTFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLQEYQDLLNVK-OH
Peptide H-HLQEYQDLLNVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TELLPGDRDNLAIQTR-OH
Peptide H-TELLPGDRDNLAIQTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EKKYFAATQFEPLAARL-OH
Peptide H-EKKYFAATQFEPLAARL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DAVEDLESVGK-OH
Peptide H-DAVEDLESVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DSQRKLQFYEDKHQLPAPKC-OH
Peptide H-DSQRKLQFYEDKHQLPAPKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SIIAYTMSLGAENSV-OH
Peptide H-SIIAYTMSLGAENSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TRQRQGIVERC-OH
Peptide H-TRQRQGIVERC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TGICNQNII-OH
Peptide H-TGICNQNII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VEAEVQIDR^-OH
Peptide H-VEAEVQIDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNKIVRMYSPTSILD-OH
Peptide H-LNKIVRMYSPTSILD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LDETVVNR-OH
Peptide H-LDETVVNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VTSEGAGLQLQK-OH
Peptide H-VTSEGAGLQLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KYNKANAFL-OH
Peptide H-KYNKANAFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VSQYIEWLQK-OH
Peptide H-VSQYIEWLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Beta-Amyloid (1-39)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C203H311N55O60SPeso molecolare:4,514.04 g/molH-NRLDRCLKAVRKER-OH
Peptide H-NRLDRCLKAVRKER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FRDYVDRFYKTLRAEQASQD-OH
Peptide H-FRDYVDRFYKTLRAEQASQD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SHGQDYLVGNK-OH
Peptide H-SHGQDYLVGNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VPLRPMTY-OH
Peptide H-VPLRPMTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTDVAPVGFFLVLDVVYLVYESK-OH
Peptide H-LTDVAPVGFFLVLDVVYLVYESK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRSLGHPEP-OH
Peptide H-RRSLGHPEP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NNWNN-OH
Peptide H-NNWNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MSPHPHPRHHHT-OH
Peptide H-MSPHPHPRHHHT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLMPGFIHL-OH
Peptide H-YLMPGFIHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SHFLKEKGGLEGL-OH
Peptide H-SHFLKEKGGLEGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NNFTVSFWLRVPKVSASHLEQ-OH
Peptide H-NNFTVSFWLRVPKVSASHLEQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YASESMSGIPSR-OH
Peptide H-YASESMSGIPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ARTELYRSL-OH
Peptide H-ARTELYRSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QIYAGIKVK-OH
Peptide H-QIYAGIKVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLGRNSFEV-OH
Peptide H-LLGRNSFEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DINQMLNCVGDHQAA-OH
Peptide H-DINQMLNCVGDHQAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SAFPEITHA-OH
Peptide H-SAFPEITHA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLIDLPGITRV-OH
Peptide H-TLIDLPGITRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cross Linked C-Telopeptide Of Type I Collagen (CTXI)
Custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Peso molecolare:1,422.5 g/molH-KYYSIIPHSI-OH
Peptide H-KYYSIIPHSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RIIPRHLQL-OH
Peptide H-RIIPRHLQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WFDI-OH
Peptide H-WFDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLSIEQLTTLAEK-OH
Peptide H-GLSIEQLTTLAEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGSDWRFLRGYHQYAYDG-OH
Peptide H-VGSDWRFLRGYHQYAYDG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LIQNSLTIER-OH
Peptide H-LIQNSLTIER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILLQGTPVAQMTEDAVDAER-OH
Peptide H-ILLQGTPVAQMTEDAVDAER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAIQALR-OH
Peptide H-AAIQALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLNDILEAQKIELHE-OH
Peptide H-GLNDILEAQKIELHE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPPVVAKEI-OH
Peptide H-LPPVVAKEI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IQAEPDNLAR-OH
Peptide H-IQAEPDNLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FFEILSPVYR-OH
Peptide H-FFEILSPVYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FFGVGGEEDITVQTVTWPDMELPLPRNITEGE-OH
Peptide H-FFGVGGEEDITVQTVTWPDMELPLPRNITEGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PLALEGSLQK-OH
Peptide H-PLALEGSLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SFKAALSSLA-OH
Peptide H-SFKAALSSLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DDDWTHL-OH
Peptide H-DDDWTHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLAQCFFCFKELEGW-OH
Peptide H-DLAQCFFCFKELEGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NGSLQCRICI-OH
Peptide H-NGSLQCRICI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CKMQQNGYENPTYKFFEQMQN-OH
Peptide H-CKMQQNGYENPTYKFFEQMQN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLRDQQLLGIWG-OH
Peptide H-YLRDQQLLGIWG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLAIDHLNEDQLR-OH
Peptide H-VLAIDHLNEDQLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPDFTNENPLETR-OH
Peptide H-SPDFTNENPLETR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLYSALANK-OH
Peptide H-QLYSALANK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
EGF Receptor Substrate 2
Peptide EGF Receptor Substrate 2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C54H82N13O24PPeso molecolare:1,328.32 g/molH-ISPRTLNAW-OH
Peptide H-ISPRTLNAW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KGLGISYGRK-OH
Peptide H-KGLGISYGRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NYLNYGEEGAPGK-OH
Peptide H-NYLNYGEEGAPGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPDEDLAGLR-OH
Peptide H-IPDEDLAGLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSNAVHPTLRHL-OH
Peptide H-TSNAVHPTLRHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGGGDLTLGLEPSEEEAPR-OH
Peptide H-SGGGDLTLGLEPSEEEAPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TMYKNPRPVAATG-OH
Peptide H-TMYKNPRPVAATG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VIFGLFGK-OH
Peptide H-VIFGLFGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPAGPQGPR-OH
Peptide H-GPAGPQGPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSKVAPVIKARMMEYG-OH
Peptide H-LSKVAPVIKARMMEYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GEIYKRWIILGLNKI-OH
Peptide H-GEIYKRWIILGLNKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NTTGALTTR-OH
Peptide H-NTTGALTTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLLLSAALSAGK-OH
Peptide H-QLLLSAALSAGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGQEIEVRPGIVSK-OH
Peptide H-VGQEIEVRPGIVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DHIGTR-OH
Peptide H-DHIGTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LYPFTWDAVR-OH
Peptide H-LYPFTWDAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EPQYEEIPIYL-OH
Peptide H-EPQYEEIPIYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FIFSILVLA-OH
Peptide H-FIFSILVLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NFFRMVISNPAAT-OH
Peptide H-NFFRMVISNPAAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CMLVELHTQSQDRF-OH
Peptide H-CMLVELHTQSQDRF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AELLNIPFLY-OH
Peptide H-AELLNIPFLY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MAGDIS-OH
Peptide H-MAGDIS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVYDGREHTV-OH
Peptide H-GVYDGREHTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLPAKAPLL-OH
Peptide H-RLPAKAPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IEIKDTKEAL-OH
Peptide H-IEIKDTKEAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HTTDPSFLGRY-OH
Peptide H-HTTDPSFLGRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecolare:1,293.4 g/molH-KAGQVVTIW-OH
Peptide H-KAGQVVTIW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GKPIPNPLLGLDSTRTGHHHHHH-OH 817A
Peptide H-GKPIPNPLLGLDSTRTGHHHHHH-OH 817A is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRRNEQELLELDKWASLWNWFDITNWLWYIRRRR-OH
Peptide H-RRRNEQELLELDKWASLWNWFDITNWLWYIRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RRYGTSKYQ-OH
Peptide H-RRYGTSKYQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLNELQALIEAHFENR-OH
Peptide H-DLNELQALIEAHFENR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
