Peptidi
Sottocategorie di "Peptidi"
Trovati 29608 prodotti di "Peptidi"
H-SLMDLLSSL-OH
Peptide H-SLMDLLSSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
CAS:H-HGEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Formula:C148H223N39O46Peso molecolare:3,284.63 g/molH-LLLLLLLLLLKKK-NH2
Peptide H-LLLLLLLLLLKKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YTDVSNMSHLA-OH
Peptide H-YTDVSNMSHLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLNEKDYELLCLDGTR-OH
Peptide H-NLNEKDYELLCLDGTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NAPVAIPQ-OH
Peptide H-NAPVAIPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLYRLFRKSNLKPFE-OH
Peptide H-YLYRLFRKSNLKPFE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SNLELLR-OH
Peptide H-SNLELLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AGIGKIGDFIKKAIAKYKN-OH
H-AGIGKIGDFIKKAIAKYKN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-KRPPIFIRRL-OH
Peptide H-KRPPIFIRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NFLINETAR-OH
Peptide H-NFLINETAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STHVDIRTLEDLLMG-OH
Peptide H-STHVDIRTLEDLLMG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IDEALER-OH
Peptide H-IDEALER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HQKLVFFA-NH2
Peptide H-HQKLVFFA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPNAGQMQPVK-OH
Peptide H-IPNAGQMQPVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SCSSCPLSK-OH
Peptide H-SCSSCPLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLPAPITR-OH
Peptide H-DLPAPITR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SESIKKKVL-OH
Peptide H-SESIKKKVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2
H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-NAVEVLKR-OH
Peptide H-NAVEVLKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLWAQCVQL-OH
Peptide H-KLWAQCVQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TITLEVESSDTIDNVK-OH
Peptide H-TITLEVESSDTIDNVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIVLTQSPATLSLSP-OH
H-EIVLTQSPATLSLSP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-RADEEQQQALSSQMGF-OH
H-RADEEQQQALSSQMGF-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-AALEDTLAETEAR-OH
Peptide H-AALEDTLAETEAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGSC-OH
Peptide H-GGSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLDTASTTL-OH
Peptide H-NLDTASTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SESGQFHAF-OH
Peptide H-SESGQFHAF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FYLYDSETK-OH
Peptide H-FYLYDSETK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYGPVFMSL-OH
Peptide H-TYGPVFMSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LQTHIFAEV-OH
Peptide H-LQTHIFAEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IDIDID-OH
Peptide H-IDIDID-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLRRSSCFGGRMDRIGAQSGLGCNSFRYRITAREDKQGWA-OH
H-SLRRSSCFGGRMDRIGAQSGLGCNSFRYRITAREDKQGWA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-HPVAEADYFEY-OH
Peptide H-HPVAEADYFEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HPVGDADYFEY-OH
Peptide H-HPVGDADYFEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVIPCGESCVFIPCISTLLGCSCKNKVCYRN-OH
H-GVIPCGESCVFIPCISTLLGCSCKNKVCYRN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-VPAINVNDSVTK-OH
Peptide H-VPAINVNDSVTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CTNPVQLDDFD-NH2
Peptide H-CTNPVQLDDFD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVLEGGIDPILR-OH
Peptide H-VVLEGGIDPILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MGEKG-OH
Peptide H-MGEKG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPTLHEYML-OH
Peptide H-TPTLHEYML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KELYPLTSL-OH
Peptide H-KELYPLTSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSRLPFGMA-OH
Peptide H-LSRLPFGMA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LDLER-OH
Peptide H-LDLER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPFNDGVYF-OH
Peptide H-LPFNDGVYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.ACTGSTQHQCG-NH2
Peptide ACTGSTQHQCG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C40H63N15O17S2Peso molecolare:1,090.16 g/molH-RAHYNIVTFCCKCDS-OH
Peptide H-RAHYNIVTFCCKCDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TESTT-OH
Peptide H-TESTT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLGEFLKLDRERAKN-OH
Peptide H-TLGEFLKLDRERAKN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CRRRRRRRR-OH
Peptide H-CRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STTVKAACWW-OH
Peptide H-STTVKAACWW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIVGAVLK-OH
Peptide H-DIVGAVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AGEALYE-OH
Peptide H-AGEALYE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KSWMESEF-OH
Peptide H-KSWMESEF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAAAAAAAAAAAA-OH
H-AAAAAAAAAAAAA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-LRRGQILWFRGLNRIQTQIK-OH
CAS:Peptide H-LRRGQILWFRGLNRIQTQIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C113H190N38O26Peso molecolare:2,497 g/molH-PPPP-OH
Peptide H-PPPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VEITPYKPTW-OH
Peptide H-VEITPYKPTW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FNLAGNHEQEFLR-OH
Peptide H-FNLAGNHEQEFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C194H295N55O57Peso molecolare:4,309.81 g/molH-QEEEEDEDEER-OH
Peptide H-QEEEEDEDEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLKDAIKDL-OH
Peptide H-VLKDAIKDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTFASLSELHCDK-OH
Peptide H-GTFASLSELHCDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPFA-OH
Peptide H-VPFA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IAIPTNFTI-OH
Peptide H-IAIPTNFTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NNYMYAR-OH
Peptide H-NNYMYAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HP-OH
Peptide H-HP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AFDQIDNAPEEK-OH
Peptide H-AFDQIDNAPEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IALYLQQNW-OH
Peptide H-IALYLQQNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C55H81N13O14Peso molecolare:1,148.32 g/molH-GERIVDII-OH
Peptide H-GERIVDII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TFSWASVTSK-OH
Peptide H-TFSWASVTSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGSGLVGR-OH
Peptide H-SGSGLVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TWSKVGGHLRPGIVQSG-OH
Peptide H-TWSKVGGHLRPGIVQSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IALTNSVNEALLNPSR-OH
Peptide H-IALTNSVNEALLNPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RMPEAAPPV-OH
Peptide H-RMPEAAPPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VYVHPF-OH
Peptide H-VYVHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Formula:C203H311N55O60SPeso molecolare:4,514.1 g/molH-GCTVHG-OH
Peptide H-GCTVHG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MEVDPIGHLY-OH
Peptide H-MEVDPIGHLY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C53H80N12O16SPeso molecolare:1,173.35 g/molH-CSTGSIDMVD-OH
Peptide H-CSTGSIDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TRFASVYAW-OH
Peptide H-TRFASVYAW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2
H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-QLSESQVK-OH
Peptide H-QLSESQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIQTAVR-OH
Peptide H-EIQTAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EFTPVLQADFQK-OH
Peptide H-EFTPVLQADFQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TEKLWVTVYYGVPVWREATT-OH
Peptide H-TEKLWVTVYYGVPVWREATT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CGKRK-OH
Peptide H-CGKRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FSVYWAQADR-OH
Peptide H-FSVYWAQADR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-APAHRSSTFPKWVTKTERGRQPLRS-OH
Peptide H-APAHRSSTFPKWVTKTERGRQPLRS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AKFERLQTVTNYFITSE-OH
Peptide H-AKFERLQTVTNYFITSE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AFSPEVIPMFSALSEGATPQ-OH
Peptide H-AFSPEVIPMFSALSEGATPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAQELEEK-OH
Peptide H-VAQELEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQSGIGEK-OH
Peptide H-FQSGIGEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DTDILAAFR-OH
Peptide H-DTDILAAFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WGW-OH
Peptide H-WGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GISYGRQLGKKKHRRRAHQ-OH
Peptide H-GISYGRQLGKKKHRRRAHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VERYLRDQQLLGIWG-OH
Peptide H-VERYLRDQQLLGIWG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CINGVCWTV-OH
Peptide H-CINGVCWTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LQTAPVPMPDLK-OH
Peptide H-LQTAPVPMPDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TVGVEPAADGK-OH
Peptide H-TVGVEPAADGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
