Peptidi
Sottocategorie di "Peptidi"
Trovati 29707 prodotti di "Peptidi"
α-Bag Cell Peptide (1-7)
Catalogue peptide; min. 95% purity
Formula:C44H67N13O9Peso molecolare:922.11 g/molRef: 3D-VAC-00244
Prodotto fuori produzione[Arg3] Substance P
Catalogue peptide; min. 95% purity
Formula:C63H98N20O13SPeso molecolare:1,375.67 g/molRef: 3D-VAC-00678
Prodotto fuori produzioneCaspase 1 Substrate 1m (ICE), fluorogenic
Catalogue peptide; min. 95% purity
Formula:C35H41N5O12Peso molecolare:723.7 g/molRef: 3D-VAC-00058
Prodotto fuori produzioneP62 (417-429), M. leprae
Catalogue peptide; min. 95% purity
Formula:C65H116N16O17Peso molecolare:1,393.75 g/molRef: 3D-VAC-00573
Prodotto fuori produzioneRnase (90-105)
H-SKYPNCAYKTTQANKH-OH peptide, corresponding to RNase A 90-105 (Chain A of bovine pancreatic ribonuclease); min. 95% purity
Formula:C80H124N24O25SPeso molecolare:1,854.08 g/molRef: 3D-VAC-00726
Prodotto fuori produzioneKGF Receptor Peptide
Catalogue peptide; min. 95% purity
Formula:C114H174N30O42SPeso molecolare:2,668.90 g/molRef: 3D-VAC-00491
Prodotto fuori produzioneRef: 3D-VAC-00224
Prodotto fuori produzioneTNF-α (72-82), human
Catalogue peptide; min. 95% purity
Formula:C48H86N18O16Peso molecolare:1,171.33 g/molRef: 3D-VAC-00629
Prodotto fuori produzione[Cys(Acm)20,31]-EGF (20-31)
Catalogue peptide; min. 95% purity
Formula:C63H98N16O23S3Peso molecolare:1,543.77 g/molRef: 3D-VAC-00265
Prodotto fuori produzioneRef: 3D-VAC-00507
Prodotto fuori produzioneAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formula:C264H406N80O77S3Peso molecolare:6,028.72 g/molRef: 3D-VAC-00919
Prodotto fuori produzioneBiotin-a-CGRP (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Formula:C172H276N52O54S3Peso molecolare:4,032.63 g/molRef: 3D-VAC-00115
Prodotto fuori produzioneZ-Gly-Gly-Trp-OH TFA
CAS:Please enquire for more information about Z-Gly-Gly-Trp-OH TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C23H24N4O6•C2HF3O2Purezza:Min. 95%Peso molecolare:566.48 g/molAloc-DL-Orn (Boc)-OH·DCHA
CAS:Prodotto controllatoPlease enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C14H24N2O6·C12H23NPurezza:Min. 95%Peso molecolare:497.67 g/molRef: 3D-FA107927
Prodotto fuori produzioneFmoc-Glu(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Ref: 3D-FF111727
Prodotto fuori produzioneFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C43H47FN4O15Purezza:Min. 95%Peso molecolare:878.85 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP47266
Prodotto fuori produzioneGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SPeso molecolare:5,040.74 g/molRef: 3D-VAC-00849
Prodotto fuori produzione[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Formula:C189H285N55O57SPeso molecolare:4,271.67 g/molRef: 3D-VAC-00911
Prodotto fuori produzione[Tyr8,Nle11] Substance P
Catalogue peptide; min. 95% purity
Formula:C64H100N18O14Peso molecolare:1,345.62 g/molRef: 3D-VAC-00677
Prodotto fuori produzione
![[Arg3] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00678.webp&w=3840&q=75)
![[Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00265.webp&w=3840&q=75)
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)