Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30471 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
TAPI-O
<p>Peptide TAPI-O is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 107 (AMAGASTSAGRKRKS)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,478.7 g/molH-GISYGRQ^LG^KK^KHRR^RAHQ-OH
<p>Peptide H-GISYGRQ^LG^KK^KHRR^RAHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>TAPI-2
<p>Peptide TAPI-2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSCSSWLDKECVY^FCHLDIIW^VNTPEQTAPYGL^GNPP-OH
<p>H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-KLVVVGAVGV^-OH
<p>Peptide H-KLVVVGAVGV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>EBV BRLF-1 148-156 (HLA-A*03:01)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:TKSVY2Peso molecolare:1,143.3 g/molThymosin β 4
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C212H350N56O78SPeso molecolare:4,963.5 g/molH-ILGQQVPYATK^-OH
<p>Peptide H-ILGQQVPYATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLAVYQAGAR^-OH
<p>Peptide H-RLAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Angiotensin II (3-8), human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C40H54N8O8Peso molecolare:774.9 g/molH-TEFTTALQR-OH
<p>Peptide H-TEFTTALQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PP44822
Prodotto fuori produzioneH-NLDTASTTL-OH
<p>Peptide H-NLDTASTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PH00369
Prodotto fuori produzioneH-NWAPGEPNNR-OH
<p>Peptide H-NWAPGEPNNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PP43977
Prodotto fuori produzione4,4,4,4',4',4'-Hexafluoro-DL-valine
CAS:Formula:C5H5F6NO2Purezza:>98.0%(T)Colore e forma:White to Almost white powder to crystalPeso molecolare:225.09H-IYQEPFKNLK-OH
<p>Peptide H-IYQEPFKNLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PP45105
Prodotto fuori produzioneH-WRQAAFVDSY-OH
<p>Peptide H-WRQAAFVDSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PP47815
Prodotto fuori produzioneH-GDSLAYGLR-OH
<p>Peptide H-GDSLAYGLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PP45139
Prodotto fuori produzione
