
Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30476 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-GISYGRQ^LG^KK^KHRR^RAHQ-OH
<p>Peptide H-GISYGRQ^LG^KK^KHRR^RAHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>4,4,4,4',4',4'-Hexafluoro-DL-valine
CAS:Formula:C5H5F6NO2Purezza:>98.0%(T)Colore e forma:White to Almost white powder to crystalPeso molecolare:225.09Nα-(tert-Butoxycarbonyl)-N1-formyl-L-tryptophan
CAS:Formula:C17H20N2O5Purezza:>98.0%(T)Colore e forma:White to Light gray to Light yellow powder to crystalPeso molecolare:332.36H-VIYEQANAHGQ-OH
<p>Peptide H-VIYEQANAHGQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PH00533
Prodotto fuori produzioneN-(tert-Butoxycarbonyl)-4-bromo-D-phenylalanine
CAS:Formula:C14H18BrNO4Purezza:>98.0%(HPLC)Colore e forma:White to Almost white powder to crystalPeso molecolare:344.21H-NLDTASTTL-OH
<p>Peptide H-NLDTASTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PH00369
Prodotto fuori produzioneH-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH
<p>H-NKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C211H318N62O59S3Peso molecolare:4,763.42 g/molRef: 3D-PH00368
Prodotto fuori produzioneH-WRQAAFVDSY-OH
<p>Peptide H-WRQAAFVDSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PP47815
Prodotto fuori produzioneProstaglandin A1
CAS:<p>Prostaglandin A1 is a bioactive lipid, which is derived from arachidonic acid through enzymatic pathways. It functions as a signaling molecule with various biological activities, influencing vascular tone, inflammation, and smooth muscle activity. Prostaglandins are a subset of eicosanoids, which are synthesized from essential fatty acids found within phospholipid membranes of cells.</p>Formula:C20H32O4Purezza:Min. 95%Peso molecolare:336.47 g/molH-ALVEICTEM-OH
<p>Peptide H-ALVEICTEM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PP45982
Prodotto fuori produzioneH-GDSLAYGLR-OH
<p>Peptide H-GDSLAYGLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PP45139
Prodotto fuori produzioneH-VAANIVLTV-OH
<p>Peptide H-VAANIVLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PP46205
Prodotto fuori produzioneH-GYGFGLIK-OH
<p>Peptide H-GYGFGLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PP48389
Prodotto fuori produzioneH-ALNRTSSDSALHRRR-OH
<p>Peptide H-ALNRTSSDSALHRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-ALNRTSSDSALHRRR-OH include the following: Enhanced activation of cellular AMPK by dual-small molecule treatment: AICAR and A769662 S Ducommun , RJ Ford, L Bultot - American Journal , 2014 - journals.physiology.org<a href="https://journals.physiology.org/doi/abs/10.1152/ajpendo.00672.2013" target="_blank" rel="noreferrer noopener">https://journals.physiology.org/doi/abs/10.1152/ajpendo.00672.2013</a> Characterization of WZ4003 and HTH-01-015 as selective inhibitors of the LKB1-tumour-suppressor-activated NUAK kinases S Banerjee , SJ Buhrlage, HT Huang , X Deng - Biochemical , 2014 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/457/1/215/46906" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/457/1/215/46906</a> Interplay between Polo kinase, LKB1-activated NUAK1 kinase, PP1betaMYPT1 phosphatase complex and the SCFbetaTrCP E3 ubiquitin ligase S Banerjee , A Zagorska, M Deak - Biochemical , 2014 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/461/2/233/46874" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/461/2/233/46874</a> Inhibition of SIK2 and SIK3 during differentiation enhances the anti-inflammatory phenotype of macrophages NJ Darling , R Toth, JSC Arthur , K Clark - Biochemical Journal, 2017 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/474/4/521/49590" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/474/4/521/49590</a> Comparison of the specificity of Trk inhibitors in recombinant and neuronal assays KJ Martin, N Shpiro, R Traynor, M Elliott , JSC Arthur - Neuropharmacology, 2011 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0028390811001389" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0028390811001389</a> Enhanced activation of cellular AMPK by dual small GR Kemp, K Sakamoto - 2014 - journals.physiology.org<a href="https://journals.physiology.org/doi/prev/20140114-aop/epdf/10.1152/ajpendo.00672.2013" target="_blank" rel="noreferrer noopener">https://journals.physiology.org/doi/prev/20140114-aop/epdf/10.1152/ajpendo.00672.2013</a> The AMPK-related kinase SIK2 is regulated by cAMP via phosphorylation at Ser358 in adipocytes E Henriksson, HA Jones, K Patel , M Peggie - Biochemical , 2012 - portlandpress.com<a href="https://portlandpress.com/biochemj/article-abstract/444/3/503/46279" target="_blank" rel="noreferrer noopener">https://portlandpress.com/biochemj/article-abstract/444/3/503/46279</a></p>Ref: 3D-PP43446
Prodotto fuori produzioneH-WHWLQLKPGQPMY-OH
<p>Peptide H-WHWLQLKPGQPMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-WHWLQLKPGQPMY-OH include the following: Position one analogs of the Saccharomyces cerevisiae tridecapeptide pheromone YL Zhang, HUIFEN LU, JM Becker - The Journal of peptide , 1997 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1997.tb01190.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1997.tb01190.x</a> Synthesis, Biological Activity, and Conformational Analysis of Peptidomimetic Analogues of the Saccharomyces cerevisiae alpha-Factor Tridecapeptide YL Zhang, HR Marepalli, H Lu, JM Becker - Biochemistry, 1998 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi980787u" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi980787u</a> Receptor in Saccharomyces cereuisiae SK RathsSQ, M BeckerSII - researchgate.net<a href="https://www.researchgate.net/profile/Jeffrey-Becker-2/publication/20308809_Peptide_analogs_compete_with_binding_of_-factor_to_its_receptor_in_Saccharomyces_cerevisiae/links/09e415111549c85414000000/Peptide-analogs-compete-with-binding-of-factor-to-its-receptor-in-Saccharomyces-cerevisiae.pdf" target="_blank" rel="noreferrer noopener">https://www.researchgate.net/profile/Jeffrey-Becker-2/publication/20308809_Peptide_analogs_compete_with_binding_of_-factor_to_its_receptor_in_Saccharomyces_cerevisiae/links/09e415111549c85414000000/Peptide-analogs-compete-with-binding-of-factor-to-its-receptor-in-Saccharomyces-cerevisiae.pdf</a> Peptide analogues compete with the binding of alpha-factor to its receptor in Saccharomyces cerevisiae. SK Raths, F Naider, JM Becker - Journal of Biological Chemistry, 1988 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0021925819778405" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0021925819778405</a> Binding of fluorinated phenylalanine alpha-factor analogues to ste2p: Evidence for a cation-Ã⬠binding interaction between a peptide ligand and its cognate G protein S Tantry, FX Ding, M Dumont , JM Becker, F Naider - Biochemistry, 2010 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi100280f" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi100280f</a> Position 13 analogs of the tridecapeptide mating pheromone from Saccharomyces cerevisiae: design of an iodinatable ligand for receptor binding S Liu, B Arshava, F Naider, LK Henry - Journal of Peptide , 2000 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-3011.2000.00730.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1034/j.1399-3011.2000.00730.x</a> Ab initio calculations on Pro-Ala and Pro-Gly dipeptides O Antohi, F Naider, AM Sapse - Journal of Molecular Structure , 1996 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/0166128095043608" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/0166128095043608</a> Structural requirement tryptophan1,3 of tridecapeptide mating pheromone of Saccharomyces cerevisiae NJ Hong, YA Park, JW Lee - : Proceedings of the 1st International Peptide , 2002 - Springer<a href="https://link.springer.com/content/pdf/10.1007/0-306-46864-6_157.pdf" target="_blank" rel="noreferrer noopener">https://link.springer.com/content/pdf/10.1007/0-306-46864-6_157.pdf</a> Studies on conformational consequences of i to i+ 3 side-chain cyclization in model cyclic tetrapeptides MH RAO, WEI YANG, H JOSHUA - Journal of Peptide , 1995 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1995.tb01057.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1995.tb01057.x</a> Specificity characterization of the alpha-mating factor hormone by Kex2 protease MA Manfredi, AA Antunes, LOP Jesus, MA Juliano - Biochimie, 2016 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0300908416302358" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0300908416302358</a> Control of the yeast cell cycle with a photocleavable alpha-factor analogue LL Parker , JW Kurutz, SBH Kent - Chemie (International ed , 2006 - ncbi.nlm.nih.gov<a href="https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2788609/" target="_blank" rel="noreferrer noopener">https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2788609/</a> Matrix-assisted laser desorption/ionization mass spectrometry peptide sequencing utilizing selective N-terminal bromoacetylation J Song, HJ Kim - Analytical biochemistry, 2012 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0003269711007548" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0003269711007548</a> Solution Structures of i to i + 3 Cyclized Model Peptides: Building Blocks Mimicking Specific Conformations HR Marepalli, O Antohi, JM Becker - Journal of the American , 1996 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/ja954217i" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/ja954217i</a> Highly active analogs of alpha-factor and their activities against Saccharomyces cerevisiae HJ Ahn, EY Hong, DH Jin, NJ Hong - Bulletin of the Korean Chemical , 2014 - Citeseer<a href="https://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=509ee315e2cbcb9fac108f48dfb1fa89d076f1b2" target="_blank" rel="noreferrer noopener">https://citeseerx.ist.psu.edu/document?repid=rep1&type=pdf&doi=509ee315e2cbcb9fac108f48dfb1fa89d076f1b2</a> Identification of residue-to-residue contact between a peptide ligand and its G protein-coupled receptor using periodate-mediated dihydroxyphenylalanine cross GKE Umanah, L Huang , F Ding, B Arshava - Journal of biological , 2010 - ASBMB<a href="https://www.jbc.org/article/S0021-9258(20)60639-1/abstract" target="_blank" rel="noreferrer noopener">https://www.jbc.org/article/S0021-9258(20)60639-1/abstract</a> Cross-linking of a DOPA-containing peptide ligand into its G protein-coupled receptor GKE Umanah, C Son , FX Ding, F Naider - Biochemistry, 2009 - ACS Publications<a href="https://pubs.acs.org/doi/abs/10.1021/bi802061z" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/abs/10.1021/bi802061z</a> Structural requirements for alpha-mating factor activity G Houen, O Nielsen, C Flanagan - FEBS letters, 1996 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/0014579396007260" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/0014579396007260</a> The alpha-factor mating pheromone of Saccharomyces cerevisiae: a model for studying the interaction of peptide hormones and G protein-coupled receptors F Naider, JM Becker - Peptides, 2004 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0196978104002943" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0196978104002943</a> Studies on the yeast alpha-mating factor: A model for mammalian peptide hormones F Naider, J Gounarides, CB Xue - Biopolymers , 1992 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1002/bip.360320407" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1002/bip.360320407</a> Probing the Binding Site of a Heptahelical Peptide Pheromone Receptor Using Photoaffinity Labelling, Site-Directed Mutagenesis and Spectroscopic Approaches F Naider, BK Lee, LK Henry, F Ding, SK Khare - Peptides: The Wave of , 2001 - Springer<a href="https://link.springer.com/chapter/10.1007/978-94-010-0464-0_409" target="_blank" rel="noreferrer noopener">https://link.springer.com/chapter/10.1007/978-94-010-0464-0_409</a> Biophysical studies on a transmembrane peptide of the Saccharomyces cerevisiae alpha-factor receptor F Naider, B Arshava, H Xie, S Liu, WY Eng - Peptides for the New , 2002 - Springer<a href="https://link.springer.com/content/pdf/10.1007/0-306-46881-6_151.pdf" target="_blank" rel="noreferrer noopener">https://link.springer.com/content/pdf/10.1007/0-306-46881-6_151.pdf</a> Characterization of novel peptide agonists of the alpha mating factor of Saccharomyces cerevisiae EG Siegel, R Gunther, H Schafer, UR Fölsch - Analytical , 1999 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0003269799942896" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0003269799942896</a> Antagonistic and synergistic peptide analogs of the tridecapeptide mating pheromone of Saccharomyces cerevisiae E Eriotou-Bargiota , CB Xue, F Naider, JM Becker - Biochemistry, 1992 - ACS Publications<a href="https://pubs.acs.org/doi/pdf/10.1021/bi00117a036" target="_blank" rel="noreferrer noopener">https://pubs.acs.org/doi/pdf/10.1021/bi00117a036</a> Probing the functional conformation of the tridecapeptide mating pheromone of Saccharomyces cerevisiae through study of disulfide-constrained analogs CHUB XUE, A MCKINNEY, HUIFEN LU - journal of peptide , 1996 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1996.tb01336.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1996.tb01336.x</a> Spiegel, zyxwvutsrqponm B Molitoris, AC Alfrey, RA Harris, FR Simon - Am. J. Physiol, 1985 - academia.edu<a href="https://www.academia.edu/download/41221846/Antagonistic_and_synergistic_peptide_ana20160115-15517-198v4vt.pdf" target="_blank" rel="noreferrer noopener">https://www.academia.edu/download/41221846/Antagonistic_and_synergistic_peptide_ana20160115-15517-198v4vt.pdf</a> Long-distance rotational echo double resonance measurements for the determination of secondary structure and conformational heterogeneity in peptides B Arshava, M Breslav, O Antohi, RE Stark - Solid State Nuclear , 1999 - Elsevier<a href="https://www.sciencedirect.com/science/article/pii/S0926204099000181" target="_blank" rel="noreferrer noopener">https://www.sciencedirect.com/science/article/pii/S0926204099000181</a> Synthesis of biologically active analogs of the dodecapeptide alpha-factor mating pheromone of Saccharomyces cerevisiae A EWENSON, S MARCUS - Journal of Peptide , 1990 - Wiley Online Library<a href="https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1990.tb00944.x" target="_blank" rel="noreferrer noopener">https://onlinelibrary.wiley.com/doi/abs/10.1111/j.1399-3011.1990.tb00944.x</a></p>Ref: 3D-PP43346
Prodotto fuori produzioneH-DRFYKTLRAEQASQEV-OH
<p>Peptide H-DRFYKTLRAEQASQEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PP43158
Prodotto fuori produzioneH-TEFTTALQR-OH
<p>Peptide H-TEFTTALQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PP44822
Prodotto fuori produzioneH-KLQVFLIVL-OH
<p>Peptide H-KLQVFLIVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PP45485
Prodotto fuori produzioneH-VYIHPF-OH
<p>Peptide H-VYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ref: 3D-PP41828
Prodotto fuori produzione1-Benzyl-5-oxopyrrolidine-3-carboxylic Acid
CAS:Formula:C12H13NO3Purezza:>98.0%(GC)(T)Colore e forma:White to Almost white powder to crystalPeso molecolare:219.24

