Peptidi
Sottocategorie di "Peptidi"
Trovati 29708 prodotti di "Peptidi"
Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
CAS:Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form. One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAFormula:C192H295N61O60SPurezza:Min. 95%Peso molecolare:4,449.93 g/molHXB2 gag NO-93
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,698 g/molH-LASYQAAR^-OH
Peptide H-LASYQAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[Cy3B]-LifeAct (Abp140 1-17)
[Cy3B]-LifeAct (Abp140 1-17) contains the 17amino acid peptide Lifeact derived from amino acids 1-17 of the Saccharomyces cerevisiae actin binding protein, Abp140. These first 17 amino acids of Abp140 are crucial in allowing Lifeact to localise to actin filaments (F-actin) and therefore it can be used as a cytoskeletal marker. On application, lifeact can be used in the study of plant development and pathogen defence as filamentous actin within the plant actin cytoskeleton is important in key processes such as cell division, membrane trafficking and stomatal movements.The addition of the Cy-Dye fluorophore, Cy3B allows the location of the LifeAct (Abp140 1-17) to be detected. Cy3B is described as being conformationally locked meaning it is less likely to undergo photo-isomerization and one of its main applications is within DNA related studies.Colore e forma:PowderPeso molecolare:2,465.2 g/molCMV IE-1 (213-225)
CMV pp65 (415-429) (HLA-B7) is a CEF (cytomegalovirus, Epstein-Barr virus, and influenza virus) control peptide that is derived from the Cytomegalovirus (CMV). CMV is capable of infecting a wide range of human cell types, where the body's primary immune response to CMV is innate, and relies on inflammatory cytokines and costimulatory molecules in order to control the spread of the virus. CMV pp65 (415-429) (HLA-B7) is defined as a CEF control peptide due to its antigenic properties. Clinically, these peptides are suitable epitopes for CD8+ T cells and can be used to stimulate the release of IFNg. HLA-B7 refers to the cell HLA type that this peptide acts on.Peso molecolare:1,516.8 g/molH-VWESATPLR^-OH
Peptide H-VWESATPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALLFIPR^-OH
Peptide H-ALLFIPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Temporin L
Temporin L is a highly potent anti-microbial peptide (AMP) active against both Gram-positive and Gram-negative bacteria. Temporins are a large family of short, linear, AMPs produced in the skin of frogs belonging to Rana species, but are also found in wasp venom. Temporin L was originally isolated from the frog Rana temporaria and has the highest anti-microbial potency among tested temporins, especially against Gram-negative bacteria.Temporin L increases bacterial inner membrane permeability in a dose-dependent manner without destroying cell integrity. At low peptide concentrations, the inner membrane becomes permeable to small molecules but this does not kill the bacteria. At high concentrations, larger molecules, but not DNA, leak out, resulting in cell death. Temporin L has a different mode of action to many AMPs as it does not lyse the cells but instead forms ghost-like bacteria shells.Colore e forma:PowderPeso molecolare:1,639 g/molH-TEYKLVVVGADGVGK^-OH
Peptide H-TEYKLVVVGADGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GITNIN-NH2
Peptide Ac-GITNIN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLEVTAYSPLGSSDR^-OH
Peptide H-GLEVTAYSPLGSSDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5-FAM-Fz7-21
Fz7-21 is a potent and selective peptide antagonist of Frizzled 7 (FZD 7) receptor which selectively binds to FZD7 cysteine rich domain (CRD) subclass at the cysteine rich region proximal to the lipid-binding groove. Binding alters the conformation of the CRD and the architecture of its lipid-binding groove and impairs Wnt/β-catenin signalling. Peptide Fz7-21 also shows cross-species binding to both the human and mouse FZD7 CRD.The FZD7 receptor is enriched in intestinal stem cells which express the LGR5 receptor and plays a critical role in the cells self-renewal. FZD7 is essential for maintaining human embryonic stem cells in their undifferentiated state and is therefore an attractive pharmacological target for diseases associated with stem cell dysfunction and cancer biology.FZD7 is also upregulated in subsets of colon, pancreatic and gastric tumours, therefore Fz7-21 serves as a pharmacological probe to explore further the function of FZD7 in stem cell and cancer biology.Peptide is labelled with an N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.
Peso molecolare:2,110.8 g/molPlasmodium falciparum CSP 334-342 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFmoc-11-aminoundecanoic acid
CAS:Fmoc-11-Aminoundecanoic Acid is a molecular modeling reagent that interacts with other elements to form Building Blocks. Fmoc-11-Aminoundecanoic Acid has been shown to have cancer interacting properties, elucidating the molecular interactions of peptides and proteins. It has been used in research as an active analog for growth factors. Fmoc-11-Aminoundecanoic Acid interacts with other molecules, including peptides and proteins, by proteolysis to produce new molecules. The chemical structure of this molecule can be altered through reactions with other molecules such as amino acids or nucleotides.
Formula:C26H33NO4Purezza:Min. 98.0 Area-%Peso molecolare:423.56 g/molH-SLDLDSIIAEVK^-OH
Peptide H-SLDLDSIIAEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-D-His(Trt)-OH
CAS:Fmoc-D-His(Trt)-OH is a chiral building block that is used in peptide synthesis. It can be used to synthesize an enantiomer or homologue of the original amino acid. Fmoc-D-His(Trt)-OH has been postulated to exist as two stereoisomers, 1R,2S and 2R,1S. The 1R,2S enantiomer is the naturally occurring form of this compound and is produced with a shift of +6 ppm in the proton NMR spectrum. The 2R,1S enantiomer has also been observed in the solid state but not in solution and it exhibits a shift of -6 ppm in the proton NMR spectrum. Fmoc-D-His(Trt)-OH is soluble in solvents such as DMSO and DMF. It has also been shown to be a potent inhibitor of organophosphate and reFormula:C40H33N3O4Purezza:Min. 95%Peso molecolare:619.73 g/molZ-GLF-CMK
Peptide Z-GLF-CMK is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGIVDEGALLR^-OH
Peptide H-GGIVDEGALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLSLSP-NH2
Peptide H-SLSLSP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![[Cy3B]-LifeAct (Abp140 1-17)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1130929.webp&w=3840&q=75)
