CymitQuimica logo
Peptidi

Peptidi

I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.

Sottocategorie di "Peptidi"

Trovati 29708 prodotti di "Peptidi"

Ordinare per

Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
prodotti per pagina.
  • HXB2 gag NO-83/aa329 - 343


    Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

    Peso molecolare:1,514.9 g/mol

    Ref: 3D-PP50313

    ne
    Prezzo su richiesta
  • H-ANELLINVK^-OH


    Peptide H-ANELLINVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00041

    ne
    Prezzo su richiesta
  • H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH


    Peptide H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00475

    ne
    Prezzo su richiesta
  • H-CSCSSWLDKECVY^FCHLDIIW^VNTPEQTAPYGL^GNPP-OH


    H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

    Ref: 3D-PH00067

    ne
    Prezzo su richiesta
  • H-GNPESSFNDENLR^-OH


    Peptide H-GNPESSFNDENLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00190

    ne
    Prezzo su richiesta
  • H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQR-OH


    Peptide H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00599

    ne
    Prezzo su richiesta
  • H-ALLESSLR^QA-OH


    Peptide H-ALLESSLR^QA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00034

    ne
    Prezzo su richiesta
  • H-DTHFPICIFCCGCCHRSKCGMCCK^T-OH


    Peptide H-DTHFPICIFCCGCCHRSKCGMCCK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP46203

    ne
    Prezzo su richiesta
  • Peptide YY (Dog, Mouse, Porcine, Rat, 3-36)

    CAS:
    PYY (3-36), a Y2 receptor agonist, is released from the body's gastrointestinal tract in proportion to caloric intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake by 33% over 24h, which suggests that PYY (3-36) has a role in 'longer term' regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drugs for the treatment of obesity. This product is available as an Acetate salt.
    Formula:C176H272N52O54
    Purezza:Min. 95%
    Peso molecolare:3,980.45 g/mol

    Ref: 3D-PYY-3726-PI

    1mg
    499,00€
    5mg
    1.587,00€
  • [Glp6,Pro9] Substance P (6-11)/Septide


    Tachykinins are important neuropeptides throughout the nervous system involved in various roles including smooth muscle activity. Substance P is the natural ligand for neurokinin 1 (NK1) tachykinin receptor. Septide was originally identified from the C-terminus substance P and found to be a selective agonist of NK1 tachykinin receptor. Septide is a potent agonist able to stimulate muscle contraction in various models but not all. However, septide consistently lacks a high affinity for the NK1 tachykinin receptor compared to substance P or other applicable agonists. A 'septide sensitive' receptor is speculated, or it could be a conformation of NK1 tachykinin receptor. Further work is required to establish septide function and role in the nervous system. Septide is provided here with an N-terminal pyroglutamic acid to aid this investigation as is standardly used within the literature.
    Peso molecolare:763.4 g/mol

    Ref: 3D-CRB1000628

    1mg
    282,00€
    500µg
    206,00€
  • H-VYIHP^F-OH


    Peptide H-VYIHP^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP45648

    ne
    Prezzo su richiesta
  • H-DQFPEVYVPTVFENYVADIEVDGK^-OH


    Peptide H-DQFPEVYVPTVFENYVADIEVDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP42347

    ne
    Prezzo su richiesta
  • H-LIQNSLTIER^-OH


    Peptide H-LIQNSLTIER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP49131

    ne
    Prezzo su richiesta
  • H-GPSVFPLAPSSR^-OH


    Peptide H-GPSVFPLAPSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00200

    ne
    Prezzo su richiesta
  • H-SNLELLR^-OH


    Peptide H-SNLELLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00469

    ne
    Prezzo su richiesta
  • H-EVTVDTTLAGYHLPK^-OH


    Peptide H-EVTVDTTLAGYHLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00137

    ne
    Prezzo su richiesta
  • LCBiot-AHGVTSAPDTRPAPGSTAPPA-OH


    Peptide LCBiot-AHGVTSAPDTRPAPGSTAPPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP47807

    ne
    Prezzo su richiesta
  • SMAC/DIABLO -TAT (48-60)-[Lys]


    SMAC/DIABLO -TAT (48-60)-[Lys] is a pro-apoptotic peptide that is derived from the mitochondrial protein known either as Second Mitochondria-Derived Activator of Caspases (Smac) or Direct IAP Binding Protein with low isoelectric point, pI (DIABLO). During apoptosis the mitochondria has increased permeability to Smac/DIABLO, which causes the protein to diffuse into the cytosol. Here, Smac/DIABLO adheres to Inhibitors of apoptosis proteins (IAPs) and prevents them from binding to caspases, which in turn accentuates apoptosis.TAT (48-60) is present due to its properties as a cell penetrating cationic peptide (CPP). It derived from the N-terminus of the Tat protein, which is a trans-activator of the transcription protein present in the human immunodeficiency virus (HIV). As a CPP, TAT (48-60) is able facilitate the delivery of the Beclin scrambled protein across the plasma membrane.This peptide has an additional lysine attached to the C-terminus of the TAT (48-60) sequence.

    Colore e forma:Powder
    Peso molecolare:2,650.6 g/mol

    Ref: 3D-CRB1000573

    1mg
    282,00€
    500µg
    206,00€
  • H-TENNDHINLK^-OH


    Peptide H-TENNDHINLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PP40373

    ne
    Prezzo su richiesta
  • H-GPEQTQGNFGDQELIR^-OH


    Peptide H-GPEQTQGNFGDQELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

    Ref: 3D-PH00192

    ne
    Prezzo su richiesta