Peptidi

<p>Peptide H-GTVGGYFL^AGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QTALVELVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FALPQYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-PQNLLLDPDTAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-dPEG®4-Glu[dPEG®4(Cyclo(Arg-Gly-Asp-d-Phe-Lys))]2 is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>

<p>pE-HWSY(dW)L^RP-NHEt is a catalog research peptide that is held in stock. pE-HWSY(dW)L^RP-NHEt is provided at &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer pE-HWSY(dW)L^RP-NHEt in bulk quantities in addition to our standard pack sizes.Please enquire for more information about pE-HWSY(dW)L^RP-NHEt at the technical inquiry form on this page</p>

<p>Peptide H-LDELLQSQIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-Myr-GSNK^SK^PK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-LDLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cyclo(-Pro-Val) is a type of natural product that has been shown to inhibit the growth of tumor cells. Cyclo(-Pro-Val) is a metabolite produced by the fungus Cryptococcus neoformans and may serve as a potential anti-cancer drug. The compound blocks mitochondrial membrane potential, which prevents cancer cells from multiplying. Cyclo(-Pro-Val) has also been shown to inhibit the growth of bacteria such as Pseudomonas aeruginosa and Burkholderia cepacia complex, although it has little or no effect on other types of bacteria and fungi.</p>

<p>Peptide ÎŽ-MSH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Tos-Gly-Pro-Lys-pNA acetate is a peptide that has been shown to have inhibitory effects on serine proteases, such as fibrinogen. Tos-Gly-Pro-Lys-pNA acetate binds to the active site of serine proteases, which inhibits their activity and prevents them from cleaving fibrinogen. The rate of reaction is dependent on the concentration of enzyme inhibitors. For example, at low concentrations, the enzyme inhibitor will bind to only one or two sites on the serine protease, while at high concentrations it may bind to many sites. This molecule has been shown to be a potent inhibitor of human immunodeficiency virus (HIV) protease and is currently being studied for its use as a potential antiviral agent.</p>

<p>Peptide H-FFVPPFQQSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QFYDQALQQAVVDDDANNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LDLSSLAYSGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Suc-Ala-Ala-Ala-AMC is a fluorogenic substrate that can be used to measure the activity of serine proteases. Suc-Ala-Ala-Ala-AMC has been shown to have high values in mammalian tissue. It also has high activity against many bacteria and fungi, as well as proteolytic enzymes such as collagenase and matrix metalloproteinase. This substrate is activated by phorbol esters and has an optimum pH of 5.5. Suc-Ala-Ala-Ala AMC is a model protein for determining the antibacterial efficacy of various antibiotics.</p>

<p>Peptide H-DLPAPITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VVGACGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NFLINETAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>