
Peptidi
Sottocategorie di "Peptidi"
Trovati 29635 prodotti di "Peptidi"
H-SYSMEHFRWGKPV-NH2
Peptide H-SYSMEHFRWGKPV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SFHAAAYVPAGR^-OH
Peptide H-SFHAAAYVPAGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTILELFR^-OH
Peptide H-VTILELFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ile-Ile-Thr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C16H31N3O5Peso molecolare:345.43 g/molGP120 - W61D - 55
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,600.9 g/molAc-PGLPLSLQNG-NH2
Peptide Ac-PGLPLSLQNG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyclo[Arg-Gly-Asp-D-Phe-Lys(Ac-SCH2CO)]
This product is an RGD Peptide containing a Thioacetyl Group for Linking to Liposomes. It may require further derivatization and deprotection before use
Formula:C31H45N9O9SPurezza:Min. 95%Peso molecolare:719.82 g/molRef: 3D-PCI-3699-PI
Prodotto fuori produzioneH-2Kb core MGLKFRQL
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-LLILAFSR^-OH
Peptide H-LLILAFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILPTLEAVAALGNK^-OH
Peptide H-ILPTLEAVAALGNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LANFLVHSSNNFGAILSSTNV^GSNTY-OH
Peptide H-LANFLVHSSNNFGAILSSTNV^GSNTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ARPALEDLR^-OH
Peptide H-ARPALEDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Galantide
Galantide is a reversible and non-specific galanin receptor antagonist. In vitro it dose dependently antagonizes galanin mediated inhibition of the glucose induced insulin secretion from mouse pancreatic islets. In vivo intracerebroventricular injection of galanin inhibits sexual behavior in male rats without producing any other locomotor or behavioral deficit. Galantide has been found to improve social memory in animal models.
Peso molecolare:2,198.1 g/molNeuromedin B (porcine)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C52H73N15O12SPeso molecolare:1,132.3 g/molB8R (20 - 27)
B8R (20-27) is derived from the B8R protein, a virulence factor of the poxvirus. Due to B8R being a homolog of the extracellular domain of the IFN- γ receptor, B8R can bind to and prevent IFN- γ from binding to its receptor. IFN- γ has antiviral activity against encephalomyocarditis virus and the vesicular stomatitis virus is inhibited when B8R is expressed.
Peso molecolare:959.5 g/molH-PSEKTFKQRRTFEQC-NH2
Peptide H-PSEKTFKQRRTFEQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SASFNTDPYVR^-OH
Peptide H-SASFNTDPYVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LL-37 fragment (30-37)
LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37, this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also regulates many aspects of the innate immune system and overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis, making LL-37 the most studied form of the human cathelicidin peptides.More recently, studies have shown that LL-37 binds to SARS-CoV-2 S protein and inhibits binding to its receptor hACE2, which may inhibit viral entry into the cell. LL-37 is upregulated by vitamin D, therefore this may be one mode of action for the positive outcomes seen with vitamin D treatment for Covid-19.
Peso molecolare:914.5 g/molH-TPAYYPNAGLIK^-OH
Peptide H-TPAYYPNAGLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 97
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,772.1 g/molH-TEGLQEALLK^^-OH
Peptide H-TEGLQEALLK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KIVL-NH2
Peptide H-KIVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5Fam-DRVYIHPF-OH
Peptide 5Fam-DRVYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FESSAAKLKRKYWWKNLK^-OH
Peptide H-FESSAAKLKRKYWWKNLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Calcitonin, Rat
The hormone Calcitonin, reduces the amount of serum calcium during hypercalcemia and is released from the C-cells of the thyroid gland. Within its structure it contains a disulphide bridge between cysteine 1 and 7 and a proline at its carboxy terminal.Calcitonin is used therapeutically in the treatment of hypercalcemia diseases such as Paget disease, Sudeck atrophy, bone metastases and vitamin-D intoxication.The level of calcitonin in the plasma can also be used as a marker for medullary thyroid carcinoma, while procalcitonin is used to diagnose sepsis.
Peso molecolare:3,397.6 g/molClickPTD-5
protein transduction domain PTD-5 is a cell-penetrating peptide (CPP). PTD-5 is well characterised for its ability to carry conjugates into the cell with high efficiency and induce low toxicity. Several papers have demonstrated the efficacy of PTD-5 as a CPP- PTD-5 was also conjugated to KLA to produce a pro-apoptotic peptide named DP1 which is selective for mitochondrial and bacterial membranes.PTD-5 is labelled at the N-terminus with an alkyne attachment for ease of reaction with an opposite Click reactive partner (azide). Azide-alkyne cycloaddition has become the most popular Click reaction. Alkyne-PTD-5 allows various applications, particularly for protein conjugation, modification, and drug delivery.
Colore e forma:PowderPolybia-MPI
Polybia-MPI is a short cationic alpha-helical amphiphilic anti-microbial peptide which was first isolated from the venom of the social wasp Polybia paulista. Polybia-MPI displays potent anti-bacterial activity against both Gram-positive and Gram-negative bacteria and is able to disrupt biofilms. Polybia-MPI also has anti-fungal activity against C. albicans and C. galbrata and selective toxicity toward cancer cells. Polybia-MPI has low toxicity to normal fibroblasts and human red blood cells, showing no haemolytic activity.
Peso molecolare:1,653 g/molεV1-2
εV1-2 is a selective inhibitor of ε protein kinase C.ε protein kinase C is an isoymes of the protein kinase C family, which is a family involved in controlling the function of other proteins via phosphorylation of hydroxyl groups of serine and threonine amino acid residues.In vitro studies have shown εV1-2 to exhibit inhibitory properties on endothelial cell proliferation.Colore e forma:PowderPeso molecolare:843.5 g/molJelleine 4
Jelleines are a family of very small (8-9 amino acid residues long) host defence peptides (HDPs) isolated from the royal jelly of honey bees (Apis mellifera). Jelleines do not present any similarity with other HDPs from other honeybees and are produced by the workers and secreted into Royal Jelly and provide abroad-spectrum protection of the bee hive against microbial infections. The Jelleines are not considered cytolytic or directly involved with inflammatory effects.PLEASE NOTE that in several published articles the sequence of Jelleine-3 has been printed as TPFKISLH -NH2, due to a mistake in the original reference: Fontana et al., (2004). The correct sequence, is TPFKISIH -NH2.
Peso molecolare:940.6 g/molH-SDAPIGK^-OH
Peptide H-SDAPIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
GGG-C(AF647) C-Terminal Sortagging
GGG-C(AF647) C-Terminal Sortagging
Colore e forma:PowderPeso molecolare:1,285.4 g/molH-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH
Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Histone H3 (1-20) K4Me3, K9Ac, pS10-GG-Biotin
Histone H3 (1 - 20) K4Me3 is derived from Histone 3 (H3), which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Like the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing many lysine and arginine residues, they have a positive net charge which interacts electrostatically with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone-modifying enzymes which target histone proteins. Both processes alter the positioning of the nucleosome, allowing the DNA to be either available or inaccessible to the transcription machinery.Histone tails can undergo multiple modifications, including acetylation, methylation, ubiquitylation and sumoylation. The modification pattern is believed to alter chromatin function/structure. Lysine 4 of histone H3 (1 - 20) K4Me3 has been tri-methylated, lysine 9 has been acetylated, and serine 10 has been phosphorylated and labelled with Biotin. This peptide can be used to study the function of this pattern on chromatin availability and histone effectors via crystallisation, pull-down assays and protein blots.
Peso molecolare:2,814.5 g/molSARS-CoV-2 Spike (781-795)
The SARS-CoV-2 spike protein is present on the outside of the virus particles and can bind to angiotensin-converting enzyme II (ACE2) present on the host cells. The C-terminal receptor binding domain (RBD) of the spike protein binds to the N-terminal peptidase M2 domain of ACE2. This receptor binding results in the internalisation of the virus-receptor complex and is, therefore the mechanism of entry of SARS-CoV-2 into host cells.The spike protein residues VFAQVKQIYKTPPIK (781-795) from C have been identified as a T-cell epitope with a predicted HLA restriction. Immune targeting of confirmed epitopes may potentially offer protection against SARS-CoV-2 and help the development of vaccines for long-lasting immunity.
Peso molecolare:1,759 g/molH-RP^QQPYPQPQPQY-OH
Peptide H-RP^QQPYPQPQPQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cys-Kemptide
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C35H66N14O10S1Peso molecolare:875.1 g/molAcrAP1a
Venom peptidomes and proteomes have the potential for significant inroads to novel drug discovery. The non-disulphide bridge peptides (NDBPs) have become a particular focus due to their large range of apparent structures and biological activity while retaining high specificity. Additionally, it has been found that a few site-specific modifications or post-translational modifications can have significant impacts on the potency of their biological effects.Within the peptidome AcrAP1 was identified in the NDBP as having antimicrobial and bactericidal activity. The nascent peptide contains a predicted hydrophobic region, this was altered to lysine residues generating a hydrophilic region, AcrAP1a. This cationic enhancement markedly increases their antibacterial potency against bacteria and yeast. Furthermore, at relatively high concentrations, it inhibited proliferation of several cancer cell lines but at low concentrations in 2 cell lines the growth was significantly promoted. The duality of AcrAP1a on growth modulation in cancer cell lines as well as having potent antimicrobial activity suggests it is a useful analogue for further research in bacteria and eukaryotes.
Peso molecolare:2,075.67 g/molH-TLYSSSPR^-OH
Peptide H-TLYSSSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
PAR-2 (1-6) (mouse, rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C29H56N10O7Peso molecolare:656.83 g/molCMV pp65 (485-500)
CMV pp65 (415-429) (HLA-B7) is a CEF (cytomegalovirus, Epstein-Barr virus, and influenza virus) control peptide that is derived from the Cytomegalovirus (CMV). CMV is capable of infecting a wide range of human cell types, where the body's primary immune response to CMV is innate, and relies on inflammatory cytokines and costimulatory molecules in order to control the spread of the virus. CMV pp65 (415-429) (HLA-B7) is defined as a CEF control peptide due to its antigenic properties. Clinically, these peptides are suitable epitopes for CD8+ T cells and can be used to stimulate the release of IFNg. HLA-B7 refers to the cell HLA type that this peptide acts on.
Colore e forma:PowderPeso molecolare:1,761 g/molHEL46-61
Amino acids 46 to 61 of the hen egg lysozyme (HEL). Lysozyme hydrolyses the bond between-N-acetyl glucosamine and-N-acetyl muramic acid (muramidase activity) leading to degradation of peptidoglycan (PG) in the cell wall of Gram-positive bacteria, it also inactivates certain viruses. HEL enhances phagocytic activity of polymorphonuclear leukocytes and macrophages, and stimulates proliferation and anti-tumour functions of monocytes.The bacterial defence properties of lysozyme may be related to structural properties and not to its bacteriolytic action. Genetically inactive lysozyme is a potent bactericide against Gram-positive bacteria in the absence of its enzyme activity.
Colore e forma:PowderPeso molecolare:1,751.8 g/molAc-NQSYQYGPSSAGNGAGC-NH2
Peptide Ac-NQSYQYGPSSAGNGAGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 95
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,650 g/molH-TFERRN-NH2
Peptide H-TFERRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 78
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,720 g/molAc-KKLETFSSTN-OH
Peptide Ac-KKLETFSSTN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLIYFTSSLHSGVPSR^-OH
Peptide H-VLIYFTSSLHSGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GSGFFVFSR^-OH
Peptide H-GSGFFVFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Click pep-1
Pep-1 is a synthetic cell penetrating peptide (CPP) and has been successfully used to deliver a variety of proteins and other biopharmaceutical macromolecules into cells in a non-disruptive manner. It is a CPP with primary amphipathicity, which results from its amino acid sequence as opposed to its folding structure. The primary structure of Pep-1 comprises three main domains: a tryptophan-rich, 'hydrophobic' domain, a hydrophilic domain derived from an NLS (nuclear localisation signal) of SV40 (simian virus 40) large T-antigen, and a spacer.Pep-1 is provided here with a N-terminal alkyne attachment. Two of the most regularly encountered functional groups for click chemistry are azides and alkynes, and the azide-alkyne cycloaddition has become the most popular click reaction. The use of click chemistry with alkyne-Pep1 allows a wide variety of applications particularly for conjugation, modification and peptide design.
Colore e forma:PowderPeso molecolare:2,840.5 g/molH-EGKKLVAASQAAL^GL-OH
Peptide H-EGKKLVAASQAAL^GL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
pE-MAVKKYLNSILN-NH2
CAS:pE-MAVKKYLNSILN-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Cilengitide
Cilengitide is a cyclic arginine-glycine-aspartic acid (RGD) motif containing peptide that selectively inhibits the integrin alphav subunit. Integrins are cell adhesion molecules which mediate cell-cell and cell-matrix interactions and creating a scaffold for tissue organisation. Integrins also act to regulate cell attachment, proliferation, differentiation, apoptosis and motility.Integrin alphav can form heterodimers with integrin subunits β1, β3, β5, β6, or β8. Cilengitide is a highly selective antagonist of alphavβ3 and alphavβ5 integrins. It also and shows anti-angiogenic effects and inhibits growth and promotes apoptosis of tumour cells that express integrins, such as glioblastoma.Cilengitide has gone on to phase II trials for cancers such as glioblastoma, melanoma, prostate, breast, lung and head and neck cancers.
Peso molecolare:1,234 g/molBak BH3
The Bak BH3 peptide is derived from the pro-apoptotic proteins BAK and BH3, which are both members of the BCL-2 family proteins. It can bind to Bcl-xL, antagonize its anti-apoptotic function, and rapidly induce apoptosis.The process of apoptosis can be activated by the intrinsic or extrinsic pathways, the former is activated by stress stimuli such as DNA damage and nutrient deficiency, while the latter is induced through activation of the death receptors FAS and TRAIL.The BCL-2 family's transmembrane anchor at the C-terminus allows them to locate at the mitochondrial outer membrane and play a vital role in apoptosis.Within the mitochondria BH3 molecules, containing the members BID, BIM, PUMA and NOXA, can be activated by the intrinsic pathway. These in turn can initiate the homo-oligomerisation of BAX and BAK which induce mitochondrial outer membrane permeabilisation (MOMP) and the release of cytochrome c into the cytosol. Here cytochrome c associates with APAF-1 and dATP, ultimately activating effector caspase3/7 and apoptosis.
Colore e forma:PowderPeso molecolare:1,723.9 g/molRibosomal protein L3 peptide (202-222) amide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C114H182N42O25SPeso molecolare:2,573 g/molHistone H3 (1-20)
Histone H3 (1-20) with a C-terminal tryptophan (W) is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into a structure known as the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.
Peso molecolare:2,368.4 g/molCMVpp65 - 61 (FMHVTLGSDVEEDLT)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,692.9 g/molSARS-CoV-2 NSP13 (236-250)
The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication. NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (236-250) is an epitope candidate with various predicted HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.
Peso molecolare:1,709.9 g/mol[Tyr0]-Apelin-13
[Tyr0]-Apelin-13 is derived from the apelin peptide which acts as a ligand for the apelin receptor (APJ) G protein coupled receptor and is a substrate for angiotensin converting enzyme 2. Preprapelin, encoded for by APLN located on Xq25-26.1, is cleaved to form either apelin-36 or apelin-17, 12 and apelin-13. As a member of the adipokine hormone family, which are involved in processes such as vascular homeostasis and angiogenesis, apelin is secreted from adipose tissue.Apelin has been found to be expressed in the spinal cord and the human brain and when performing immunohistochemistry it was observed that Apelin-17 is significantly expressed in the human heart, brain, lungs and endothelial cells.Both apelin and the apelin receptor are widely distributed around the body thus apelin has been found to be associated with cardiovascular diseases, obesity, diabetes and cancer. Studies exploring myocardial infarction showed there to be greater apelin mRNA expression during human heart failure compared to in healthy tissue. Apelin protects against heart failure due to, the pyroglutamyl form of apelin, playing a role in decreasing infarct size of myocardial infarctions. Furthermore in rats with hypertension, the expression of apelin and APJ was decreased.
Peso molecolare:1,712.9 g/molGLP-1 (9-36) amide
CAS:Natural cleavage product of GLP-1 which, unlike GLP-1, does not affect either insulin secretion or glucose homeostasis. GLP-1(9-36) has low affinity for, and acts as an antagonist to, the GLP-1 receptor.GLP-1 (9-36) does however display unique biological activities such as beneficial cardiovascular effects and reducing the production of reactive oxygen species (ROS). GLP-1 (9-36) also exerts important physiological effects on neuronal plasticity in the hippocampus, and inhibits chemokine-induced migration of human CD4-positive lymphocytes.GLP-1 (9-36) is formed from the breakdown of biologically active but highly unstable GLP-1 (7-36) amide by the ubiquitous serine protease, dipeptidyl peptidase-IV (DPP-IV).
Colore e forma:PowderPeso molecolare:3,087.6 g/molRef: 3D-CRB1000982
Prodotto fuori produzioneLarazotide
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C32H55N9O10Peso molecolare:725.83 g/molFluor-VPMLK-OH
Peptide Fluor-VPMLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-PVKRRLDL-OH
Peptide Biot-PVKRRLDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CLSHPYLYAQLDGPR-NH2
Peptide Ac-CLSHPYLYAQLDGPR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QLQPFPQPELPY-OH
Peptide H-QLQPFPQPELPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP48597
Prodotto fuori produzioneH-SYGIPFIETSAK^-OH
Peptide H-SYGIPFIETSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SDKNEKSHKYETLNISKC-NH2
Peptide Ac-SDKNEKSHKYETLNISKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5TAMRA-DPIYALSWSGMA-OH
Peptide 5TAMRA-DPIYALSWSGMA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-PKPPKPVSKMRMATPLLMQA-OH
Peptide Biot-PKPPKPVSKMRMATPLLMQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
gp91 ds-TAT
The gp91 ds-TAT peptide is composed of a gp91phox sequence conjugated to the human immunodeficiency virus-TAT peptide. The TAT sequence facilitates its entry into all cells, hence it is a cell-penetrating peptide. The gp91 peptide is the haem binding sub-unit of the superoxide-generating NADPH oxidase. As a result, the gp91 ds-TAT peptide can be used as a selective inhibitor of NADPH oxidase assembly.Recent studies have shown that gp91 ds-TAT can increase blood nitric oxide bioavailability in hind limb ischaemia and reperfusion by inhibiting NADPH oxidase.
Colore e forma:PowderPeso molecolare:2,671.6 g/molPMX 53
PMX 53 is a potent antagonist of CD88, a G protein-coupled receptor for C5a (complement protein). C5a is a protein fragment released from cleavage of complement component C5 by protease C5-convertase into C5a and C5b fragments. C5a, the other cleavage product of C5, acts as a highly inflammatory peptide, encouraging complement activation, formation of the MAC, attraction of innate immune cells, and histamine release involved in allergic responses. The origin of C5 is in the hepatocyte, but its synthesis can also be found in macrophages, where it may cause local increase of C5a. C5a is a chemotactic agent and an anaphylatoxin- it is essential in the innate immunity but it is also linked with the adaptive immunity. The increased production of C5a is connected with a number of inflammatory diseases.By antagonising the C5a receptor, PMX can be used to modulate inflammatory responses, obesity, development and cancers.
Colore e forma:PowderPeso molecolare:895.5 g/molACTH (1-24) -[5-FAM]
ACTH is a member of the melanocortins peptide family, this tropic hormone is produced and secreted by the anterior pituitary gland. ACTH is an important component of the hypothalamic-pituitary-adrenal (HPA) axis and is often produced in response to biological stress. ACTH acts to increase the production and release of cortisol via its interaction with ACTHR. Receptor activation increases the intracellular concentration of cAMP via adenylyl cyclase. Abnormal ACTH levels in the body have been linked to primary adrenal insufficiency/Addison's disease, Cushing's disease and secondary adrenal insufficiency.It contains 5-Carboxyfluorescein (5-FAM), a widely used green fluorescent tag.
Peso molecolare:3,330.7 g/molSARS-CoV-2 Spike (1197-1206)
The SARS-CoV-2 spike protein is present on the outside of the virus particles and can bind to angiotensin-converting enzyme II (ACE2) present on the host cells. The C-terminal receptor binding domain (RBD) of the spike protein binds to the N-terminal peptidase M2 domain of ACE2. This receptor binding results in the internalisation of the virus-receptor complex and is, therefore the mechanism of entry of SARS-CoV-2 into host cells.The spike protein residues LIDLQELGKY (1197-1206) have been identified as a T-cell epitope with a predicted HLA restriction. Immune targeting of confirmed epitopes may potentially offer protection against SARS-CoV-2 and help the development of vaccines for long-lasting immunity.
Peso molecolare:1,190.7 g/molBiotin-LPETAG N-terminal Sortagging
This peptide is recognised and cleaved by the enzyme Sortase A (SrtA) from-Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA, serves as a nucleophile to cleave the peptide bond between threonine and glycine. Cleavage results in the formation of a thioacyl intermediate between the peptide and SrtA. This intermediate is then resolved by the N-terminus of an (oligo)glycine nucleophile, resulting in the creation of a new peptide bond that links the peptide and its biotin tag to the incoming nucleophile.- This method of protein labelling is known as sortagging.This peptide contains an N-terminal biotin tag for detection and purification.
Colore e forma:PowderPeso molecolare:811.4 g/molMyelin Basic Protein, MBP (68-86)
This 19 amino acid fragment of myelin basic protein (MBP) can induce experimental allergic encephalomyelitis (EAE) in Lewis rats. EAE is the most commonly used experimental model for studying the human inflammatory demyelinating disease, multiple sclerosis (MS).MBP is an integral component of myelin found in the central nervous system (CNS). MBP is considered vital for the development and stability of the myelin sheath where it plays a role in membrane adhesion. MPBs constitute an extraordinarily varied collection of splice isoforms which show a myriad of post-translational modifications. MBP may be targeted by auto-antibodies in diseases such as multiple sclerosis. The low affinity of MBP (1-9) peptide for MCH class II molecules may result in MBP autoreactive T cells escaping central-tolerance, where self-reactive T cells are usually eliminated.
Colore e forma:PowderPeso molecolare:1,931.9 g/molC-Terminal Sortagging-[Lys(Biotin]
This peptide is recognised and cleaved by the enzyme Sortase A (SrtA) from-Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA, serves as a nucleophile to cleave the peptide bond between threonine and glycine. Cleavage results in the formation of a thioacyl intermediate between the peptide and SrtA. This intermediate is then resolved by the N-terminus of an (oligo)glycine nucleophile, resulting in the creation of a new peptide bond that links the peptide and its biotin tag to the incoming nucleophile.- This method of protein labelling is known as sortagging.This peptide contains an C-terminal biotin tag for detection and purification.
Colore e forma:PowderPeso molecolare:542.3 g/mol[MCA]/[Lys(Dnp)]-CoV Main Protease (Mpro) Substrate
Fluorescently labelled substrate for the severe acute respiratory syndrome coronavirus main protease (SARS-CoV Mpro).- The substrate sequence is derived from residues P4-P5' of the SARS-CoV Mpro-N-terminal autoprocessing site which has the sequence AVLQSGFRK. SARS-CoV Mpro is a key antiviral target.This peptide contains a highly fluorescent N-terminal 7-methoxycoumarin fluorophore (Mca) and a 2,4-dinitrophenyl (Dnp) quencher. Mca is efficiently quenched by resonance energy transfer to the 2,4-dinitrophenyl group when the peptide is intact, however upon cleavage of the peptide by Mpro, the Mca group and the Dnp quencher are separated and fluorescence can be detected. This therefore represents a useful tool for investigating Mpro activity.
Peso molecolare:1,514.7 g/molRef: 3D-CRB1001503
Prodotto fuori produzioneAcrAP2
Venom peptidomes and proteomes have yielded significant novel drug discoveries. The non-disulphide bridge peptides (NDBPs) have become a particular focus due to their large range of structures as well biological activity while retaining high specificity.AcrAP2 was identified as a NDBP in A. crassicauda within highly conserved family of proteins. Data shows it has antimicrobial activity against bacteria and yeast while also capable of haemolysing horse erythrocytes. However, AcrAP2 did not affect the growth of cancerous cell lines tested. Therefore, this peptide could be a useful model for modification to improve its potency. Furthermore, it may allow researchers to identify specific targets in disease pathways for new drug designs. A significant example of this, bradykinin-potentiating peptide Captopril® manages hypertension and originated from the conserved NDBP family.
Formula:C95H146N20O22Peso molecolare:1,938.31 g/mol1-Adamantanecarbonyl-Arg-Phe-NH2
Peptide 1-Adamantanecarbonyl-Arg-Phe-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TPEVDDEALEK^FDK-OH
Peptide H-TPEVDDEALEK^FDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 57 (KVYLESFCEDVPSGK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,700.9 g/molBiot-QEQLERALNSS-OH
Peptide Biot-QEQLERALNSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Neuromedin B, porcine
Peptide Neuromedin B, porcine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C52H73N15O12SPeso molecolare:1,132.3 g/molH-IVPNVLLEQGK^-OH
Peptide H-IVPNVLLEQGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LDVP peptide
The LDVP peptide (CS1), located in the type III connecting segment (V-region) of fibronectin, exhibits cell binding properties thus contributing to the adhesion of fibronectin to other cells.
Peso molecolare:442.2 g/molC-Peptide (57-87) human
Proinsulin connecting peptide (C-peptide), links the A and B chains of proinsulin. Upon enzymatic cleavage of C-peptide from pro-insulin in the pancreas, C-peptide is released into the blood stream along with insulin (A- and B-chains bonded together) in equimolar quantities. C-peptide can influence a wide variety of physiological conditions linked to diabetes, such as neuropathy, nephropathy, and encephalopathy. C-peptide is able to ameliorate and reverse the degrading effects of neuropathy in diabetes.
Peso molecolare:3,018.5 g/molGalanin (1-15) Porcine, Rat
Galanin is a widely distributed neuropeptide in the central nervous system (CNS), peripheral regions and endocrine system. Galanin interacts with 3 receptor subtypes, GalR1-3 G protein-coupled receptors inserted into the plasma membrane. Galanin has a role in energy homeostasis. Central injections of galanin to the amygdala led to food intake in rats. Galanin also acts in the CNS to inhibit neurotransmitter release, such as acetylcholine. Galanin has been implicated in numerous neurological conditions, including Alzheimer's disease, depression, and epilepsy. A better understanding of the galinergic signalling pathways may uncover a source for therapeutics for conditions such as epilepsy.Unlike human galanin, full-length porcine galanin contains only 29 amino acids and is C-terminally amidated. The first 15 residues are still highly conserved. The best-recognized effect of galanin on the endocrine pancreas is the inhibition of insulin secretion in vitro and in vivo on multiple model systems, including rats, dogs, and mice. However, the same effect cannot be achieved at the same concentrations in human models with infusions of porcine galanin. Structural activity and point mutation studies show that the N-terminal (1-15) fragment is vital for the interaction/activation of the GAL receptor and the inhibition of insulin secretion.
Peso molecolare:1,554.8 g/molH-SSLLDVLAAR^^-OH
Peptide H-SSLLDVLAAR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 103 (ELVTTERKTPRVTGG)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,643.9 g/molH-ADGVGK^SAL-OH
Peptide H-ADGVGK^SAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
JAG-1 (188-204)
JAG-1(188-204). Jagged - 1 is a cell surface ligand for in the Notch pathway. Notch receptors and ligands are present on the extracellular service of cells and require cell-cell contact for engagement. Ligand binding to Notch receptors results in the proteolytic cleavage of membrane-bound Notch receptors, thus allowing the intercellular region to be transported to the nucleus and become a transcriptional activator. The ligand-induced Notch activation is regulated by E3 ubiquitin ligases, Mindbomb1 (Mib-1) and Neuralized.JAG1 is widely expressed throughout mammalian development, across many tissues and developmental stages. Notch signalling plays a critical role in cellular fate determination including muscle cell differentiation, neurogenesis, and the development of the sensory regions of the inner ear- heart- kidney- eye- lung and other tissues.Jag-1 has been implicated in breast- cervical- colorectal- endometrial- gastric- head and neck- ovarian- hepatocellular- lung- pancreatic- prostate, and kidney and adrenocortical cancers, leukemia and lymphoma. Co-overexpression of Notch-1 and Jagged-1 predicts the poorest overall cancer survival. JAG1 mutations have also been associated Alagille syndrome.
Peso molecolare:2,105.9 g/molInterleukin-27 subunit beta (22-30)
Reactivity to human leukocyte antigens (HLAs) is a rising concern in clinical treatments such as organ transplant rejection. Understanding the epitopes and the signalling pathways leading to reactivity could produce better clinical therapies in the future. The peptides presented by the non-classical HLA-G are important for a largely tolerogenic role and are considered part of an immune checkpoint. This, therefore, makes understanding ligand characteristics and HLA-G a target for cancer therapies. Interleukin-27 subunit β (22-30) fragment has been identified as an epitope that human leukocyte antigen HLA-G naturally presents, determined by liquid chromatographic tandem mass spectrometry (LC-MS/MS). This epitope has been used extensively in the literature to help understand the natural ligand presentation of HLA-G.For example, leukocyte immunoglobulin (Ig)-like receptors (LILRs) are key regulators of the immune response and therefore targets for therapeutics. Inhibitory LILRB1 and LILRB2 with HLA-G are pivotal for immunotolerance during pregnancy and autoimmune diseases plus cancer cell immune evasion. Interleukin-27 subunit β (22-30) fragment was used in binding affinity assays to clarify the conformational plasticity of the interaction between the receptor, the HLA antigen, and the various peptides HLA-G can accommodate.
Colore e forma:PowderPeso molecolare:866.5 g/molBiotin-Histone H3 (14-34) pT22 K23Me3
H3 is a core component of the nucleosome, functioning in DNA compaction and availability to transcription machinery. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodelling. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. There is a wealth of data recording these modifications but understanding their significance is not as clear. In Caenorhabditis elegans H3K23me3 can be induced by exogenous dsRNA and this modification can persist for four generations after the dsRNA exposure has been stopped. H3K23me3 is enriched in C. elegans heterochromatic regions, the histone methyltransferase SET-32, methylates H3K23 in vitro.A 20-mer fragment of the N terminal histone tail is provided here with threonine 22 phosphorylated and lysine 23 tri-methylated (pT22 K23Me3) with an N terminal biotin label attached. The biotin label should allow for easy use in detection by fluorescence microscopy, ELISA or western blots. Alternatively, it can be purified for protein-protein interactions with the appropriate affinity purification protocol.
Colore e forma:PowderPeso molecolare:2,456.3 g/molAc-TRDIYETDYYRK-NH2
Peptide Ac-TRDIYETDYYRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Histone H3 (1-20)-[S]-Biotin
Histone H3 (1-20)-[S]-Biotin is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into a structure known as the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.Another modification process histones can undergo is biotinylation where the covalent attachment of a biotin molecule is catalysed by the enzyme Biotinidase. This cleaves biocytin to generate a biotinyl-thiester intermediate. The biotinyl can then be transferred onto the histone lysine ɛ-amino group which in this case it is covalently attached to Histone 3. Overall the biotinylation sites identified in histone 3 are: K4, K9 and K18. The presence of biotinylated histones have been detected in human cells such as lymphocytes and lymphomas.
Colore e forma:PowderPeso molecolare:2,424.4 g/molUty HY Peptide (246-254) Mouse
Graft versus host (GVH) rejection has been linked to the mismatch of minor histocompatibility (H) antigens even when matched for the major antigens of the major histocompatibility complex (MHC). The minor H antigens are encoded by autosomal and Y chromosome genes, they function as supports to MHC during synthesis. The prevention of GVH disease induced by minor H antigens is currently managed with immunosuppression. Using models and H antigen epitopes can provide research in to how GVH disease could be better managed by inducing tolerance. Mice are the preferred model for H antigen research due to their homogeneity apart from the Y chromosomal genes of the males. The peptide provided here is the T-cell epitope for the male-specific transplantation antigen (H-Y). It was derived from the mouse ubiquitously transcribed tetratricopeptide repeat gene on the Y chromosome (Uty) protein. Uty HY Peptide has been used to investigate transplantation tolerance of male to female grafts by inhibiting the effector CD4+ and CD8+ T-cell responses.
Peso molecolare:1,194.5 g/molH-EGYQDYEP^EA-OH
Peptide H-EGYQDYEP^EA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
OVA (251-264)
Ovalbumin (OVA) is the primary protein in egg-white, and is involved in initiating food allergies and asthma. It is a highly immunogenic protein and can be used for peptide conjugation in the development of antibodies.OVA (251-264) is a class I (Kb)-restricted peptide epitope of OVA. The ovalbumin fragment is presented by the class I MHC molecule, H-2Kb.
Peso molecolare:1,631.9 g/molH-GLEWVTFISYDGNNK^-OH
Peptide H-GLEWVTFISYDGNNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Galanin (1-13)
Galanin is a widely distributed neuropeptide in the central nervous system (CNS), peripheral regions and endocrine system. Galanin has a role in energy homeostasis. Central injections of galanin to the amygdala led to food intake in rats. Galanin also acts in the CNS to inhibit neurotransmitter release, such as acetylcholine. Galanin has been implicated in numerous neurological conditions, including Alzheimer's disease, depression, and epilepsy.Galanin interacts with 3 receptor subtypes, GalR1-3 which are G protein-coupled receptors inserted into the plasma membrane. GalR1 is believed to activate a Gβγ pathway to regulate MAPK activation. GalR2 can also activate the MAPK pathway, but unlike GalR1, there is detectable inositol phosphate production. GalR3 is associated with the Galphai/o pathway. Activation of the receptor leads to a cellular influx of potassium ions.The galanin active N-terminal fragment (1-16) has been identified as a highly potent agonist for the galanin receptors. This has become a basis for galanin-based peptides, which are neuroactive. These are being investigated as a potential source for anticonvulsant neuropeptides as a therapeutic for conditions such as epilepsy. A library of galanin fragments has allowed screening of their properties to be assessed. Galanin fragments have different affinities for GalR receptors. Galanin (1-13) has been shown to act as a high-affinity receptor antagonist in competitive receptor displacement tests using rats. Numerous chimeric peptides have been generated with galanin (1-13) to generate peptides for studying galinergic signalling. Examples of chimeric peptide tools used with galanin (1-13) are the neuropeptide Y fragment (named M32) and a bradykinin fragment (called M35).
Colore e forma:PowderPeso molecolare:1,346.7 g/molDystrophin (396-405)
Forms of inherited muscular dystrophy such as Duchenne muscular dystrophy (DMD) and Becker muscular dystrophy (BMD) result from mutations targeting the dystrophin gene. These disorders are X-linked, progressive, and cause the gradual weakening of the muscles leading to respiratory failure and ultimately reduces the patient lifespan.In DMD, mutations lead to the production of premature stop codons and hence the truncated dystrophin protein product is vulnerable to nonsense mediated decay and degradation. Therefore, dystrophin production in muscle cells is reduced. On the other hand, nonsense mutations which also contribute to DMD, cause exon skipping in BMD and result in an internally truncated protein product which are partially functional. The symptoms of BMD are later onset compared with DMD which develop in patients between 2 to 7 years.Treatments of dystrophin disorders are in clinical trials including antisense oligonucleotide exon skipping and gene therapy. However, the efficacies of these treatments are not easily quantified. Currently levels of muscular dystrophin are quantified by western blot which can be unreliable. The peptide provided here, aligning residues dystrophin (396-405), has been shown to provide absolute quantification of dystrophin levels from biopsies using parallel reaction monitoring. This will hopefully allow better management of dystrophin disorders with better quantifications tools based on dystrophin (396-405). Further study with this dystrophin fragment could prove to be a vital step in the understanding and treatment of dystrophin disorders. Within our catalogue we also have other peptides tested for dystrophin quantification available plus the full-length dystrophin protein.
dodecapeptide AR71
The dodecapeptide AR71 prevents melanoma inhibitory activity (MIA) dimerisation and hence inhibits (MIA). It therefore has the potential to be used as a therapeutic in melanoma.
Peso molecolare:1,550.8 g/molCE dipeptide
CE-acid is a dipeptide of glutamate and cysteine. CE-acid has a formal charge of 0 and a range of biological and chemical uses. EC-acid is also available in our catalogue.
Peso molecolare:250.1 g/molH-LGEVNTYAGDLQK^-OH
Peptide H-LGEVNTYAGDLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Mastoparan
Mastoparan is a 14-residue cationic peptide toxin isolated from the wasp Vespula lewisii venom which shows an important potency as an antimicrobial and anticancer agent but also as a Cell Permeable Peptide.
Mastoparan is mainly known to be a receptor-independant and allosteric regulator of G-protein by stimulating GTPase activity.
Besides modulating the activity of G-protein, Mastoparan have the ability to bind other intracellular targets such as Ca2+-ATP (implicated in Ca2+ release), small GTP binding proteins rho and rac, and many others.
Mastoparan also belongs to the cell permeable peptide (CPP) family. As such, Mastoparan increases the membrane conductance and permeability of planar lipid bilayer and liposomal membranes which leads to enhanced the penetration of Ca2+, Na+ or K+ ions.
Mastoparan have also a potential antibiotic effect due to its potent antimicrobial activity which can turn Mastoparan to a potential drug for infectious diseases.
Some studies have also reported that Mastoparan exhibits potent anti-cancer activities toward leukemia, myeloma, and breast cancer cells with an approximately half maximal inhibitory concentration (IC50) of 9µM, 11µM and 22µM respectively.
Mastoparan have shown to be more specific to cancer cells than to normal cells.Peso molecolare:1,478 g/molAlyteserin-1b
Alyerserin-1b is a C-terminally α-amidated 23 residue Cationic anti-microbial peptide (AMP). Anti-microbial peptides (AMPs) are produced by the innate immune system and are expressed when the host is challenged by a pathogen. The Alyerserin family of peptides was first identified in norepinephrine-stimulated skin secretions of the midwife toad-Alytes obstetricans-(Alytidae). Alyteserin-1 peptides have limited structural similarity to the ascaphins from the skins of frogs of the Leiopelmatidae family. Alyteserin-1 peptides are selective at inhibiting growth activity of Gram-negative bacteria-such as Escherichia coli and show weak haemolytic activity against human erythrocytes.Alyteserin contain at least 50% hydrophobic amino acids. Hydrophobic residues contribute to the insertion of the peptide into the hydrophobic membrane core which results in membrane disruption and death of the pathogen. Due to their mechanism of action it is less likely for resistance to develop towards them compared to conventional antibiotics.
Colore e forma:PowderPeso molecolare:2,292.76 g/molH-AF^ESLK^-OH
Peptide H-AF^ESLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EIIDLVLDR^-OH
Peptide H-EIIDLVLDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SBP2
Truncated version of SBP1, the fragment of the angiotensin-converting enzyme 2 (ACE2) peptidase domain (PD) alpha1 helix important for the interaction of ACE2 with the severe acute respiratory syndrome (SARS coronavirus receptor binding domain (SARS-CoV-2-RBD). Unlike SBP1, SBP2 does not associate with the spike RBD protein.
H-KLWVIPQ-OH PAB-003-416B
Peptide H-KLWVIPQ-OH PAB-003-416B is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QINDYVEK^-OH
Peptide H-QINDYVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
B-peptide
B-peptide is an arginine-rich cell-penetrating peptide which can be used in a chimeric fusion peptide which includes a morpholino oligomer (PMO). B-peptide enables the convalently conjugated PMOs or peptides to be transported across cell membranes and can therefore be a useful tool in delivering targeted therapies.
Peso molecolare:1,861.2 g/molPD-1 (21-35)
PD-1 (21-35) peptide is derived from the programmed cell death-1 (PD-1) which interacts with its ligand, PD-L1 to regulate immune homeostasis. PD-1 and its ligand PD-L1 are critical in regulating T cell activation, tolerance and immuno-pathology. PD-1 is an immune checkpoint and guards against autoimmunity through two mechanisms. First, it promotes apoptosis of antigen-specific T-cells in lymph nodes. Second, it reduces apoptosis in regulatory T cells.Several types of cancer cells overexpress PD-L1 in order to escape from the PD-1/PD-L1 immuno-surveillance mechanism. Consequently PD-1 inhibitors and PD-L1 inhibitors could be used as a therapeutic in the treatment of cancers.
Colore e forma:PowderPeso molecolare:1,778.9 g/molAllergen Ara h 1 (560-572)
Ara h 1 is one of the major allergenic proteins from peanut (Arachis hypogaea) which contains approximately 13 potential allergenic proteins.Ara h 1 is a member of the 7/8 S globulin (vicilin) family of seed storage proteins belonging to the cupin superfamily and is the most abundant allergen present in the peanut kernel. Ara h 1 plays an important role in the allergy sensitising procedure and can be recognised by 90% of patients with a peanut allergy.This peptide represents a tryptic peptide of Ara h 1.
Colore e forma:PowderPeso molecolare:1,375.7 g/molbeta-Amyloid (1-12) Human
Amyloid β-peptide (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD. Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.
Peso molecolare:1,424.43 g/molMelanocyte Protein PMEL 17 (256-264) (human, bovine, mouse)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C44H67N9O14Peso molecolare:946.05 g/molPTD-p65-P1 Peptide
The nuclear transcription factor NF-kappaB up regulates gene expression during inflammation and has critical roles in carcinogenesis, anti-apoptosis, invasion, and metastasis. This has led to the search for specific inhibitors of NF-kappaB to help study NF-kappaB for possible treatments for inflammatory diseases and cancer in the future.NF-kappaB is held in an inactive state in the cytoplasm as a heterodimer containing a p65 subunit. Signalling leads to revealing of a hidden nuclear localisation sequence within p65, phosphorylation of p65, and translocation to the nucleus. p65 binds to DNA and ultimately transcription of specific genes. Therefore, finding an inhibitor of the nuclear localisation sequence and phosphorylation of the p65 subunit is an attractive target.A peptide named PTD-p65-P1 was generated from the p65 DNA binding domain mimicking the phosphorylated state, attached to a membrane-translocating peptide sequence generated from antennapedia (PTD). PTD-p65-P1 has been shown to inhibit NF-kappaB binding to DNA in a dose dependent manner. This activity was also known to be specific for NF-kappaB inhibition. The inhibition of NF-kappaB activity by PTD p65-P1 was shown to be effective against a range of stimuli including cigarette smoke, interleukin 1 and hydrogen peroxide which suggests the inhibitor acts on a common step against these stimuli. The presence of PTD p65-P1 inhibits the cytoplasmic p65 subunit phosphorylation or translocation. The reporter genes tested for NF-kappaB activity showed down regulation of gene expression in the presence of PTD-p65-P1 peptide. The evidence is compelling that this peptide could be a suitable model for a selective specific inhibitor of NF-kappaB activity for therapeutic use in the future.
Colore e forma:PowderPeso molecolare:3,827.1 g/molCecropin-B
CAS:Cecropins are a lytic peptide family, originally isolated from Hyalophora cecropia. Cecropin-B is a cationic helical peptide that can form pores, this is believed to be the reason for its such potent lytic activity. Cecropin-B has been shown to be effective against both Gram-positive and Gram-negative bacteria plus numerous cancer cell lines including multidrug-resistant types. The ability to insert into the cell membrane and lead to pore formation is attributed to the amphipathic groups present creating amphipathic regions. The effectiveness of cecropin-B on cancer cells has led to further use of the peptide as a model for potential new anticancer drugs including cyclic cationic forms.
Colore e forma:PowderPeso molecolare:3,832.3 g/molH-VVVGADGVGK^-OH
Peptide H-VVVGADGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-AGCMPYVRIPTA-NH2
Peptide Ac-AGCMPYVRIPTA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ingap (104-118)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C64H100N20O22Peso molecolare:1,501.6 g/molH-ADHVSFNGYER^-OH
Peptide H-ADHVSFNGYER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLQEYQDLLNVK^-OH
Peptide H-HLQEYQDLLNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-118
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,724.9 g/molH-TITTDLLGSPFQEK^-OH
Peptide H-TITTDLLGSPFQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-AKFVAAWTLKAA-NH2
Peptide Ac-AKFVAAWTLKAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IQIDPV^K-OH
Peptide H-IQIDPV^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AEEDEILNR^-OH
Peptide H-AEEDEILNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVQEIQATFFYFTPNK^TEDTIFLR^-OH
Peptide H-SVQEIQATFFYFTPNK^TEDTIFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
PB1(703 - 711), Influenza
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C45H75N15O13Peso molecolare:1,034.19 g/molH-ALGSHHTASPWNLSPFSK^-OH
Peptide H-ALGSHHTASPWNLSPFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Proteasome-activating peptide 1 TFA
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C65H117F3N22O15S4Peso molecolare:1,632.02 g/molH-LSGLLDLALGK^-OH
Peptide H-LSGLLDLALGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VYAEVNSLR^-OH
Peptide H-VYAEVNSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-KIFMK-NH2
Peptide Ac-KIFMK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IQIIPK^-OH
Peptide H-IQIIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TLSDYNIQK^ESTLHLVLR^-OH
Peptide H-TLSDYNIQK^ESTLHLVLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Thymosin β 4
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C212H350N56O78SPeso molecolare:4,963.5 g/molH-YNSGK^-OH
Peptide H-YNSGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-43/aa169 - 183
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,563.8 g/molAc-QVPLRPMTYK-OH
Peptide Ac-QVPLRPMTYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NLNSLSEL^EVK-OH
Peptide H-NLNSLSEL^EVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Gastrin Releasing Peptide, human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C130H204N38O31S2Peso molecolare:2,859.4 g/molH-YGGFL^RRQFKVVT-OH
Peptide H-YGGFL^RRQFKVVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TEWLDGK^-OH
Peptide H-TEWLDGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TEGDGV^YTLNDK^-OH
Peptide H-TEGDGV^YTLNDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FELLPTPPLSPSR^-OH
Peptide H-FELLPTPPLSPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Rpf-NH2
Peptide Ac-Rpf-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyc-RGGLCYCRGRFCVCVGR-NH2
Peptide Cyc-RGGLCYCRGRFCVCVGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VIIYEVNK^-OH
Peptide H-VIIYEVNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVGACGV^GK^-OH
Peptide H-VVGACGV^GK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Lysine
Lysine peptide (Ac RFAAKAA COOH) is used in combination with cysteine peptide (Ac RFAACAA COOH) in the Direct Peptide Reactivity Assay (DPRA) test.
Direct Peptide Reactivity Assay is used in cosmetic applications for the characterization of the skin sensitizing potential of a substance, framed by OECD Guideline no 442.
The molecular initiating event (MIE) in skin sensitization is a binding between epidermal proteins and the sensitizing chemical substance. MIE is part of the adverse outcome pathway (AOP) of skin sensitization.
It is thanks to the properties of Lysine peptide and Cysteine peptide that the chemical binding will be able to take place, so these synthetic heptapeptides will mimic the reaction of a skin exposed to a substance.
Binding between nucleophilic proteins and electrophile substance will be measured by High Performance Liquid Chromatography (HPLC). Therefore, the decrease in Lysine peptide and Cysteine peptide levels will be a sign of sensitizing event. Depending on the rate of depletion, the sensitizing character of a molecule will be determined (see table at the bottom of the page).
In chemico DPRA test also has wider applications such as hazard classification in cosmetics, but also for pharmaceuticals and biocides. It is a good alternative to animal experimentation.Formula:C35H57O9N11Peso molecolare:775.9 g/molH-AKPALEDLR^-OH
Peptide H-AKPALEDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
E3 ubiquitin-protein ligase RNF43 (721-729)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
gp100 (614-622)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C56H101N19O11SPeso molecolare:1,248.61 g/molH-FIDKVRF-NH2
Peptide H-FIDKVRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGDTLNLNLR^-OH
Peptide H-VGDTLNLNLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HGEVCPAGW-NH2
Peptide H-HGEVCPAGW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ESLITLIEK^-OH
Peptide H-ESLITLIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SASL^HLPK-OH
Peptide H-SASL^HLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FEGDTLVNR^-OH
Peptide H-FEGDTLVNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALDLLDR^-OH
Peptide H-ALDLLDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-PTTDSTTPAPTTK-NH2
Peptide Biot-PTTDSTTPAPTTK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LRRFSTMPFMFCNINNVCNF-NH2
Peptide H-LRRFSTMPFMFCNINNVCNF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SIT-NH2
Peptide Ac-SIT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TIVTTLQDSIR^-OH
Peptide H-TIVTTLQDSIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HIF-1 α (556-574)
HIF-1 alpha (556-574) is derived from hypoxia-inducible factor 1-alpha (HIF-1 alpha), a subunit of the heterodimeric transcription factor HIF-1 and is responsible for maintaining oxygen homeostasis. HIF-1 alpha is expressed under hypoxic conditions and is oxygen sensitive. Hypoxia can occur in cancer, heart disease and pulmonary disorders.Structurally HIF-1 alpha contains a N-terminal transactivation domain (N-TAD) which stabilises HIF-1 alpha and a C-terminal transactivation domain (C-TAD) which under hypoxic conditions regulates the transcription of HIF-1 alpha. Moreover HIF-1 alpha features an oxygen dependent degradation domain containing two proline residues and a lysine532. The two proline residues are substrates of prolyl-4-hydroxylases (PHDs) which in the presence of sufficient oxygen, are hydroxylated. Similarly the lysine residue is acetylated by arrest-defective-1 and this is reduced in hypoxic conditions. These hydroxylated prolines and acetylated lysine target HIF-1 alpha for ubiquitination and degradation.
Purezza:Min. 95%Colore e forma:PowderPeso molecolare:2,253 g/molH-L^EVFYNGAWGTV^GK^-OH
Peptide H-L^EVFYNGAWGTV^GK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FL^HVTYVPA-OH
Peptide H-FL^HVTYVPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILGQQVPYATK^-OH
Peptide H-ILGQQVPYATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YGGFL^RRI-OH
Peptide H-YGGFL^RRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TTPPV^LDSDGSYFLYSK^-OH
Peptide H-TTPPV^LDSDGSYFLYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QKRAA-NH2
Peptide Ac-QKRAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVVGARGVGK^-OH
Peptide H-VVVGARGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 83
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,553.9 g/molH-VNHVTLSQPK^-OH
Peptide H-VNHVTLSQPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-16
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,599.8 g/molAc-EYLFEVDNL-NH2
Peptide Ac-EYLFEVDNL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PPYTIVYFPVR^-OH
Peptide H-PPYTIVYFPVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ADQLADESLESTR^-OH
Peptide H-ADQLADESLESTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H2N-Gln-Ala-Cys-Arg-Gly-Thr-Glu-Leu-Asp-Cys-Gly-Il
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C62H103N19O27S2Peso molecolare:1,610.72 g/molHistone H3 (116-136), C116-136
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C107H195N39O28SPeso molecolare:2,508.06 g/molH-KVLEHVVRV^-OH
Peptide H-KVLEHVVRV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ESTLHLVLRLR^GG-OH
Peptide H-ESTLHLVLRLR^GG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QLLLSAALSAGK^-OH
Peptide H-QLLLSAALSAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CKGGAKL-OH
Peptide Ac-CKGGAKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSQLQTYMI^-OH
Peptide H-LSQLQTYMI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-TTWI-NH2
Peptide Ac-TTWI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TWNDPSVQQDIK^-OH
Peptide H-TWNDPSVQQDIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GATQQILDEAER^-OH
Peptide H-GATQQILDEAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ile-Val-Ile
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C17H33N3O4Peso molecolare:343.46 g/molAc-ELESPPPPYSRYPMD-NH2
Peptide Ac-ELESPPPPYSRYPMD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TNYLTHR^-OH
Peptide H-TNYLTHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SGTLGHPGSLDETTYER^-OH
Peptide H-SGTLGHPGSLDETTYER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VEIIATMK^-OH
Peptide H-VEIIATMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AQLGDLPWQVAIK^-OH
Peptide H-AQLGDLPWQVAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WMDF-NH2
Peptide H-WMDF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecolare:606.7 g/molCMVpp65 - 39 (GKQMWQARLTVSGLA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecolare:1,646 g/molH-CSSNTPPLTCQR^-OH
Peptide H-CSSNTPPLTCQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-A^LPAPIEK-OH
Peptide H-A^LPAPIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
