Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30306 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
C16ORF48 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C16orf48 antibody, catalog no. 70R-4110</p>Purezza:Min. 95%RTDR1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RTDR1 antibody, catalog no. 70R-3433</p>Purezza:Min. 95%SLC25A35 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A35 antibody, catalog no. 70R-6514</p>Purezza:Min. 95%CIRBP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CIRBP antibody, catalog no. 70R-4931</p>Purezza:Min. 95%GPI Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPI antibody, catalog no. 70R-10234</p>Purezza:Min. 95%KCNB1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNB1 antibody, catalog no. 70R-5114</p>Purezza:Min. 95%GCS1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GCS1 antibody, catalog no. 70R-6629Purezza:Min. 95%H-SLFLGILSV-OH
<p>CD20 (188-196) is a short part of a membrane phosphoprotein, CD20, which is expressed on the surface of B cells. CD20 receptor is an important target for immunotherapy against B cell lymphoma. CD20 epitopes are used in antibodies CD20 production, such as the production of the first monoclonal antibody to be approved for the treatment of lymphoma.<br>Applications of CD20 (188-196):<br>CD20 (188-196) is involved in research to generate cytotoxic T lymphocytes and stimulate CTL responses against B cell diseases. The production of specific T cells and IFN-γ are quantified by ELISPOT. CD20 (188-196) has been identified as a highly immunogenic HLA-A2 restricted peptide. Results suggest that CD20 (188-196) may serve in immunotherapeutic strategies especially for vaccine development against certain type of blood cancer.<br>CD20 (188-196) is also used in research on cell therapy as target for T cell receptor. In fact, T cells are modified in vivo to express specific T cell receptor and then inject modified cells in B cells cancer patient in order to recognized malignant B cells and treat them.</p>PRR15 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRR15 antibody, catalog no. 70R-4462</p>Purezza:Min. 95%MANEA Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MANEA antibody, catalog no. 70R-7439</p>Purezza:Min. 95%Gabrp Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Gabrp antibody, catalog no. 70R-8071</p>Purezza:Min. 95%CREBBP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CREBBP antibody, catalog no. 70R-2027</p>Purezza:Min. 95%beta 2 Microglobulin Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of B2M antibody, catalog no. 70R-5904</p>Purezza:Min. 95%MAL-dPEG®12-Tris(-TFP Ester)3
<p>MAL-dPEG®12-Tris(-TFP Ester)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®12-Tris(-TFP Ester)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Formula:C65H81F12N3O25Purezza:Min. 95%Peso molecolare:1,532.32 g/molALG6 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ALG6 antibody, catalog no. 70R-7343</p>Purezza:Min. 95%CHMP1B Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHMP1B antibody, catalog no. 70R-4086</p>Purezza:Min. 95%FAM70A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM70A antibody, catalog no. 70R-6882</p>Purezza:Min. 95%FAM26A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM26A antibody, catalog no. 70R-4293</p>Purezza:Min. 95%DNAJB6 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DNAJB6 antibody, catalog no. 70R-2575</p>Purezza:Min. 95%KCNH6 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNH6 antibody, catalog no. 70R-5122</p>Purezza:Min. 95%Prrg3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Prrg3 antibody, catalog no. 70R-8831</p>Purezza:Min. 95%PRELP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRELP antibody, catalog no. 70R-5343</p>Purezza:Min. 95%GRIK5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRIK5 antibody, catalog no. 70R-5212</p>Purezza:Min. 95%ZNF91 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF91 antibody, catalog no. 70R-8708</p>Purezza:Min. 95%DHX15 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DHX15 antibody, catalog no. 70R-4689</p>Purezza:Min. 95%ITPRIP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ITPRIP antibody, catalog no. 70R-10202</p>Purezza:Min. 95%Pxmp3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Pxmp3 antibody, catalog no. 70R-8552</p>Purezza:Min. 95%FECH Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FECH antibody, catalog no. 70R-1130</p>Purezza:Min. 95%THUMPD2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of THUMPD2 antibody, catalog no. 70R-2826</p>Purezza:Min. 95%Onecut1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Onecut1 antibody, catalog no. 70R-7887</p>Purezza:Min. 95%TP53INP2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TP53INP2 antibody, catalog no. 70R-9644</p>Purezza:Min. 95%Complement C2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C2 antibody, catalog no. 70R-1657</p>Purezza:Min. 95%Olfm3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Olfm3 antibody, catalog no. 70R-9182</p>Purezza:Min. 95%PEX10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PEX10 antibody, catalog no. 70R-6651Purezza:Min. 95%UGT1A1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UGT1A1 antibody, catalog no. 70R-7289</p>EXOC6 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EXOC6 antibody, catalog no. 70R-3876</p>Purezza:Min. 95%Sgk3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Sgk3 antibody, catalog no. 70R-9338</p>Purezza:Min. 95%KIF22 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIF22 antibody, catalog no. 70R-5549</p>Purezza:Min. 95%GATM Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GATM antibody, catalog no. 70R-2511</p>Purezza:Min. 95%METAP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of METAP1 antibody, catalog no. 70R-2201</p>Purezza:Min. 95%IMPG2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IMPG2 antibody, catalog no. 70R-7479Purezza:Min. 95%UXS1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UXS1 antibody, catalog no. 70R-7443</p>Purezza:Min. 95%PRKAB1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PRKAB1 antibody, catalog no. 70R-3695</p>Purezza:Min. 95%CHRAC1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CHRAC1 antibody, catalog no. 70R-8326</p>Purezza:Min. 95%Beta Tubulin 2A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TUBB2A antibody, catalog no. 70R-2909</p>Purezza:Min. 95%CXorf66 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RP11-35F15.2 antibody, catalog no. 70R-6714</p>Purezza:Min. 95%GCOM1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Gcom1 antibody, catalog no. 70R-4119</p>Purezza:Min. 95%Tetraspanin 4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN4 antibody, catalog no. 70R-6337</p>Purezza:Min. 95%MAPK6 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAPK6 antibody, catalog no. 70R-9395</p>Purezza:Min. 95%KLHDC8B Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KLHDC8B antibody, catalog no. 70R-3670</p>Purezza:Min. 95%LRRC2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC2 antibody, catalog no. 70R-1280</p>Purezza:Min. 95%SERPINB13 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB13 antibody, catalog no. 70R-9693</p>Purezza:Min. 95%SDCBP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SDCBP2 antibody, catalog no. 70R-5903Purezza:Min. 95%CA5A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CA5A antibody, catalog no. 70R-9980</p>Purezza:Min. 95%CDH22 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDH22 antibody, catalog no. 70R-1834</p>Purezza:Min. 95%LOC729745 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC729745 antibody, catalog no. 70R-9038</p>Purezza:Min. 95%C3orf33 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C3orf33 antibody, catalog no. 70R-4032</p>Purezza:Min. 95%ZNF251 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF251 antibody, catalog no. 70R-8176</p>Purezza:Min. 95%EFEMP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EFEMP1 antibody, catalog no. 70R-5349</p>Purezza:Min. 95%ZNF33A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF33A antibody, catalog no. 70R-1951Purezza:Min. 95%FBXL20 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL20 antibody, catalog no. 70R-10157</p>Purezza:Min. 95%THEX1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of THEX1 antibody, catalog no. 70R-1307</p>Purezza:Min. 95%OSBPL8 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OSBPL8 antibody, catalog no. 70R-6725</p>Purezza:Min. 95%FICD Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FICD antibody, catalog no. 70R-1636</p>Purezza:Min. 95%GRSF1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRSF1 antibody, catalog no. 70R-4773</p>Purezza:Min. 95%PSMA3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PSMA3 antibody, catalog no. 70R-2309Purezza:Min. 95%BRD7 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BRD7 antibody, catalog no. 70R-8303</p>Purezza:Min. 95%ZNF454 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF454 antibody, catalog no. 70R-8169Purezza:Min. 95%Galnt3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Galnt3 antibody, catalog no. 70R-8653</p>Purezza:Min. 95%SIRT4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SIRT4 antibody, catalog no. 70R-7924</p>Purezza:Min. 95%IL28R alpha Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IL28RA antibody, catalog no. 70R-7458</p>Purezza:Min. 95%NUDT21 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUDT21 antibody, catalog no. 70R-1446</p>Purezza:Min. 95%APBB1IP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APBB1IP antibody, catalog no. 70R-4095</p>Purezza:Min. 95%ABCC11 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ABCC11 antibody, catalog no. 70R-6719</p>Purezza:Min. 95%C4ORF20 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C4orf20 antibody, catalog no. 70R-3548</p>Purezza:Min. 95%ZNF598 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF598 antibody, catalog no. 70R-8225</p>Purezza:Min. 95%TTL Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TTL antibody, catalog no. 70R-2530</p>Purezza:Min. 95%GZMA Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GZMA antibody, catalog no. 70R-9289</p>Purezza:Min. 95%RTN4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RTN4 antibody, catalog no. 70R-7137</p>Purezza:Min. 95%C7ORF29 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C7orf29 antibody, catalog no. 70R-3559Purezza:Min. 95%EPOr Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EPOR antibody, catalog no. 70R-5994</p>Purezza:Min. 95%AGPAT5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AGPAT5 antibody, catalog no. 70R-7253</p>Purezza:Min. 95%PVRL3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PVRL3 antibody, catalog no. 70R-6424</p>Purezza:Min. 95%GABRB3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GABRB3 antibody, catalog no. 70R-5196</p>Purezza:Min. 95%KIAA0999 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0999 antibody, catalog no. 70R-9253</p>Purezza:Min. 95%Calsyntenin 3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CLSTN3 antibody, catalog no. 70R-6618</p>Purezza:Min. 95%UCHL5IP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UCHL5IP antibody, catalog no. 70R-3801</p>Purezza:Min. 95%Copine I Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CPNE1 antibody, catalog no. 70R-4852</p>Purezza:Min. 95%YIF1B Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of YIF1B antibody, catalog no. 70R-6837</p>Purezza:Min. 95%IGSF11 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF11 antibody, catalog no. 70R-6403</p>Purezza:Min. 95%DDX41 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX41 antibody, catalog no. 70R-5039</p>Purezza:Min. 95%OLFML2B Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OLFML2B antibody, catalog no. 70R-6458</p>Purezza:Min. 95%RNF217 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF217 antibody, catalog no. 70R-6685</p>Purezza:Min. 95%PPP1R3A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R3A antibody, catalog no. 70R-6844</p>Purezza:Min. 95%ACOT9 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACOT9 antibody, catalog no. 70R-10190</p>Purezza:Min. 95%CD8B Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CD8B antibody, catalog no. 70R-8544</p>Purezza:Min. 95%WDR34 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WDR34 antibody, catalog no. 70R-3078</p>Purezza:Min. 95%ZNF334 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF334 antibody, catalog no. 70R-9581</p>Purezza:Min. 95%KCTD17 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCTD17 antibody, catalog no. 70R-5074</p>Purezza:Min. 95%SLC37A3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC37A3 antibody, catalog no. 70R-6591</p>Purezza:Min. 95%RAD17 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAD17 antibody, catalog no. 20R-1062</p>Purezza:Min. 95%PLEKHA4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PLEKHA4 antibody, catalog no. 70R-3639</p>Purezza:Min. 95%Lipase Blocking Peptide (Pancreatic)
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PNLIP antibody, catalog no. 70R-1591</p>Purezza:Min. 95%CD4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CD4 antibody, catalog no. 70R-9673</p>Purezza:Min. 95%C1ORF103 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf103 antibody, catalog no. 70R-3621</p>Purezza:Min. 95%SLC10A5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC10A5 antibody, catalog no. 70R-1767</p>Purezza:Min. 95%Neurexophilin 3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NXPH3 antibody, catalog no. 70R-4470</p>Purezza:Min. 95%FBXL3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL3 antibody, catalog no. 70R-2129</p>Purezza:Min. 95%BTNL8 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BTNL8 antibody, catalog no. 70R-8838</p>Purezza:Min. 95%SV2A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SV2A antibody, catalog no. 70R-6572</p>Purezza:Min. 95%Sec31a Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Sec31a antibody, catalog no. 70R-9307</p>Purezza:Min. 95%SYVN1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SYVN1 antibody, catalog no. 70R-7259</p>Purezza:Min. 95%IL11R alpha Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IL11RA antibody, catalog no. 70R-7222</p>Purezza:Min. 95%TTC9C Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TTC9C antibody, catalog no. 70R-3116</p>Purezza:Min. 95%SCAMP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SCAMP1 antibody, catalog no. 70R-9783</p>Purezza:Min. 95%SCYE1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SCYE1 antibody, catalog no. 70R-5895</p>Purezza:Min. 95%NDUFB5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NDUFB5 antibody, catalog no. 70R-6401</p>Purezza:Min. 95%SLC27A6 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC27A6 antibody, catalog no. 70R-6791</p>Purezza:Min. 95%BCL2L12 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of BCL2L12 antibody, catalog no. 70R-10366</p>Purezza:Min. 95%GNL3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GNL3 antibody, catalog no. 70R-3075</p>Purezza:Min. 95%RPL39 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPL39 antibody, catalog no. 70R-10416</p>Purezza:Min. 95%AOC2 Blocking Peptide (retina specific)
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AOC2 antibody, catalog no. 70R-7298</p>Purezza:Min. 95%LMAN2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LMAN2 antibody, catalog no. 70R-7314</p>Purezza:Min. 95%ELP2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ELP2 antibody, catalog no. 70R-3178</p>Purezza:Min. 95%TOB1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TOB1 antibody, catalog no. 70R-9144</p>Purezza:Min. 95%MGC33407 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MGC33407 antibody, catalog no. 70R-4401</p>Purezza:Min. 95%FABP3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FABP3 antibody, catalog no. 70R-3072</p>Purezza:Min. 95%Tetraspanin 17 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TSPAN17 antibody, catalog no. 70R-6679</p>Purezza:Min. 95%PNMA1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PNMA1 antibody, catalog no. 70R-2058</p>Purezza:Min. 95%SLC5A9 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC5A9 antibody, catalog no. 70R-6790</p>Purezza:Min. 95%HMBS Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HMBS antibody, catalog no. 70R-3343</p>Purezza:Min. 95%PTPRA Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTPRA antibody, catalog no. 70R-7310</p>Purezza:Min. 95%DGKQ Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DGKQ antibody, catalog no. 70R-9133</p>Purezza:Min. 95%AKR1B1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AKR1B1 antibody, catalog no. 70R-2252</p>Purezza:Min. 95%ACO2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACO2 antibody, catalog no. 70R-2446</p>Purezza:Min. 95%SLC25A14 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A14 antibody, catalog no. 70R-1750</p>Purezza:Min. 95%NRBF2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NRBF2 antibody, catalog no. 70R-4582</p>Purezza:Min. 95%Pitx1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Pitx1 antibody, catalog no. 70R-7963</p>Purezza:Min. 95%BAG6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of BAG6 antibody, catalog no. 70R-10346Purezza:Min. 95%NOSIP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NOSIP antibody, catalog no. 70R-9442Purezza:Min. 95%TRPM3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TRPM3 antibody, catalog no. 70R-1517</p>Purezza:Min. 95%FBXL20 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL20 antibody, catalog no. 70R-10156</p>Purezza:Min. 95%β-Pompilidotoxin
CAS:β-Pompilidotoxin is a neurotoxin that is found in the venom of the scorpion Pompilus. It binds to the ryanodine receptor, which is a type of calcium channel protein that regulates intracellular calcium levels. β-Pompilidotoxin blocks the release of calcium from the sarcoplasmic reticulum and inhibits the entry of calcium into cells by blocking voltage-gated sodium channels. It has been shown to be cytotoxic to ventricular myocytes and cerebellar purkinje neurons. β-Pompilidotoxin also has a physiological function in regulating glomerular filtration rate and preventing accumulation of intracellular calcium, which can lead to overload.Formula:C71H124N22O17Purezza:Min. 95%Peso molecolare:1,557.9 g/molGSPT2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GSPT2 antibody, catalog no. 70R-5565</p>Purezza:Min. 95%CFDP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CFDP1 antibody, catalog no. 70R-4525</p>Purezza:Min. 95%LOC642141 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC642141 antibody, catalog no. 70R-2169</p>Purezza:Min. 95%TANK Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TANK antibody, catalog no. 70R-8257</p>Purezza:Min. 95%FADS1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FADS1 antibody, catalog no. 70R-1837</p>Purezza:Min. 95%OGG1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OGG1 antibody, catalog no. 70R-10274</p>Purezza:Min. 95%CTSK Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CTSK antibody, catalog no. 70R-10206</p>Purezza:Min. 95%PTPRR Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTPRR antibody, catalog no. 70R-7149</p>Purezza:Min. 95%IAPP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IAPP antibody, catalog no. 70R-8513</p>Purezza:Min. 95%IL1RL2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IL1RL2 antibody, catalog no. 70R-8648Purezza:Min. 95%TGS1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TGS1 antibody, catalog no. 70R-2563</p>Purezza:Min. 95%CEBPZ Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CEBPZ antibody, catalog no. 70R-8273</p>Purezza:Min. 95%IFI44 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IFI44 antibody, catalog no. 70R-3661</p>Purezza:Min. 95%CDCA7L Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CDCA7L antibody, catalog no. 70R-3880</p>Purezza:Min. 95%IER5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of IER5 antibody, catalog no. 70R-2561</p>Purezza:Min. 95%JOSD2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of JOSD2 antibody, catalog no. 70R-4142</p>Purezza:Min. 95%Atg12 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Atg12 antibody, catalog no. 70R-9658Purezza:Min. 95%RBMS3 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RBMS3 antibody, catalog no. 70R-1318</p>Purezza:Min. 95%RGD1307041 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RGD1307041 antibody, catalog no. 70R-9487</p>Purezza:Min. 95%ENPP2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ENPP2 antibody, catalog no. 70R-6767</p>Purezza:Min. 95%RAB5C Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB5C antibody, catalog no. 70R-9551</p>Purezza:Min. 95%ZPLD1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZPLD1 antibody, catalog no. 70R-7542</p>Purezza:Min. 95%NR2F2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NR2F2 antibody, catalog no. 20R-1220</p>Purezza:Min. 95%RNF32 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GOLGA7 antibody, catalog no. 70R-2903</p>Purezza:Min. 95%Acd Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Acd antibody, catalog no. 70R-8190</p>Purezza:Min. 95%SERPINB6 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINB6 antibody, catalog no. 70R-9715</p>Purezza:Min. 95%APIP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of APIP antibody, catalog no. 70R-4451</p>Purezza:Min. 95%SPC25 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SPC25 antibody, catalog no. 70R-10378</p>Purezza:Min. 95%AURKA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AURKA antibody, catalog no. 70R-7853Purezza:Min. 95%PIWIL1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIWIL1 antibody, catalog no. 70R-3108</p>Purezza:Min. 95%ACP1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACP1 antibody, catalog no. 70R-3910</p>Purezza:Min. 95%CEACAM4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CEACAM4 antibody, catalog no. 70R-7236</p>Purezza:Min. 95%H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
<p>Beta Amyloid peptides, also called Amyloid beta peptides (Abeta peptides) are the main component of amyloid peptide plaques in the brain of patients with Alzheimer's disease. sb-PEPTIDE provides a broad range of chemically synthesized amyloid beta peptides for Alzheimer's disease research. We supply Abeta peptides of different lengths and point-mutated versions. Do not hesitate to contact us for any information.</p>SSX8 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SSX8 antibody, catalog no. 70R-9114</p>Purezza:Min. 95%SSX2IP Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SSX2IP antibody, catalog no. 70R-6039</p>Purezza:Min. 95%FLYWCH1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FLYWCH1 antibody, catalog no. 70R-10076</p>Purezza:Min. 95%C1orf96 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf96 antibody, catalog no. 70R-3970</p>SLC6A8 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A8 antibody, catalog no. 70R-7008</p>Purezza:Min. 95%KCNA10 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNA10 antibody, catalog no. 70R-1497</p>Purezza:Min. 95%INTS4 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of INTS4 antibody, catalog no. 70R-9105</p>Purezza:Min. 95%CKMM Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CKM antibody, catalog no. 70R-1984Purezza:Min. 95%WDR54 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WDR54 antibody, catalog no. 70R-10100</p>Purezza:Min. 95%PIK3R5 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PIK3R5 antibody, catalog no. 70R-4416</p>Purezza:Min. 95%ADAMTS18 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADAMTS18 antibody, catalog no. 70R-4602</p>Purezza:Min. 95%ASNA1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ASNA1 antibody, catalog no. 70R-10010</p>Purezza:Min. 95%PPP2R5A Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP2R5A antibody, catalog no. 70R-2950</p>Purezza:Min. 95%CD40L Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CD40LG antibody, catalog no. 70R-6092</p>Purezza:Min. 95%GLT8D2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GLT8D2 antibody, catalog no. 70R-7444</p>Purezza:Min. 95%PKM2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PKM2 antibody, catalog no. 70R-9543</p>Purezza:Min. 95%ZNF485 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF485 antibody, catalog no. 70R-8116</p>Purezza:Min. 95%DCP1B Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DCP1B antibody, catalog no. 70R-8999</p>Purezza:Min. 95%Vgll2 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Vgll2 antibody, catalog no. 70R-9003</p>Purezza:Min. 95%C19ORF47 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf47 antibody, catalog no. 70R-3316</p>Purezza:Min. 95%PPP2R3B Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP2R3B antibody, catalog no. 70R-5596</p>Purezza:Min. 95%
