Peptidi
Sottocategorie di "Peptidi"
Trovati 29635 prodotti di "Peptidi"
Calsyntenin 1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CLSTN1 antibody, catalog no. 70R-6778
Purezza:Min. 95%PRIM1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRIM1 antibody, catalog no. 70R-1617
Purezza:Min. 95%PRRG1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PRRG1 antibody, catalog no. 70R-6809
Purezza:Min. 95%NARG1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NARG1 antibody, catalog no. 70R-4598
Purezza:Min. 95%MCM9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MCM9 antibody, catalog no. 70R-5552
Purezza:Min. 95%VDAC3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of VDAC3 antibody, catalog no. 70R-5050
Purezza:Min. 95%TMTC4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMTC4 antibody, catalog no. 70R-6734
Purezza:Min. 95%CCS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CCS antibody, catalog no. 70R-10221
Purezza:Min. 95%Fbxo32 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Fbxo32 antibody, catalog no. 70R-9209
Purezza:Min. 95%STRAP Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of STRAP antibody, catalog no. 70R-2067
Purezza:Min. 95%TTC14 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TTC14 antibody, catalog no. 70R-4867
Purezza:Min. 95%NOVA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NOVA1 antibody, catalog no. 70R-4832
Purezza:Min. 95%Calponin 2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CNN2 antibody, catalog no. 70R-2395
Purezza:Min. 95%OR5T2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OR5T2 antibody, catalog no. 70R-6531
Purezza:Min. 95%EGLN2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EGLN2 antibody, catalog no. 70R-8034
Purezza:Min. 95%UNC84A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UNC84A antibody, catalog no. 70R-6253
Purezza:Min. 95%CACNB1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CACNB1 antibody, catalog no. 70R-5067
Purezza:Min. 95%LGALS9 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LGALS9 antibody, catalog no. 70R-5743
Purezza:Min. 95%KLK5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KLK5 antibody, catalog no. 70R-6355
Purezza:Min. 95%PDCD7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PDCD7 antibody, catalog no. 70R-6012
Purezza:Min. 95%ART3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ART3 antibody, catalog no. 70R-6841
Purezza:Min. 95%LUC7L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LUC7L antibody, catalog no. 70R-9549
Purezza:Min. 95%IFLTD1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IFLTD1 antibody, catalog no. 70R-4170
Purezza:Min. 95%CRISP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CRISP1 antibody, catalog no. 70R-5306
Purezza:Min. 95%SRRP35 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SRrp35 antibody, catalog no. 70R-4839
Purezza:Min. 95%OSTF1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OSTF1 antibody, catalog no. 70R-10362
Purezza:Min. 95%FLJ37543 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ37543 antibody, catalog no. 70R-3454
Purezza:Min. 95%Gtf2b Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Gtf2b antibody, catalog no. 70R-9577
Purezza:Min. 95%PDZK1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PDZK1 antibody, catalog no. 70R-3097
Purezza:Min. 95%LOC653186 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LOC653186 antibody, catalog no. 70R-1184
Purezza:Min. 95%MYBPH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MYBPH antibody, catalog no. 70R-6049
Purezza:Min. 95%C1QB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C1QB antibody, catalog no. 70R-5990
Purezza:Min. 95%LOXL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LOXL1 antibody, catalog no. 70R-5312
Purezza:Min. 95%GCNT4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GCNT4 antibody, catalog no. 70R-7414
Purezza:Min. 95%LTB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LTB antibody, catalog no. 70R-6690
Purezza:Min. 95%CPA6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CPA6 antibody, catalog no. 70R-9497
Purezza:Min. 95%ACP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACP1 antibody, catalog no. 70R-1276
Purezza:Min. 95%PSMB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PSMB2 antibody, catalog no. 70R-2346
Purezza:Min. 95%GPCR5A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GPCR5A antibody, catalog no. 70R-6472
Purezza:Min. 95%TBC1D24 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TBC1D24 antibody, catalog no. 70R-4064
Purezza:Min. 95%Plakophilin 2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PKP2 antibody, catalog no. 70R-6030
Purezza:Min. 95%GJC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GJC1 antibody, catalog no. 70R-6189
Purezza:Min. 95%SLC35A5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC35A5 antibody, catalog no. 70R-7166
Purezza:Min. 95%KIAA0427 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0427 antibody, catalog no. 70R-4855
Purezza:Min. 95%NECAB3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NECAB3 antibody, catalog no. 70R-3495
Purezza:Min. 95%KCNK10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK10 antibody, catalog no. 70R-5210
Purezza:Min. 95%SIAH1 Blocking Peptide
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Furthermore, this active compound undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.
LOXL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LOXL1 antibody, catalog no. 70R-5381
Purezza:Min. 95%Tgfb3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Tgfb3 antibody, catalog no. 70R-8628
Purezza:Min. 95%WDTC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of WDTC1 antibody, catalog no. 70R-3541
Purezza:Min. 95%C17ORF49 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C17orf49 antibody, catalog no. 70R-3752
Purezza:Min. 95%TMED4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMED4 antibody, catalog no. 70R-1481
Purezza:Min. 95%TMEM16A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM16A antibody, catalog no. 70R-7004Purezza:Min. 95%ZNF486 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF486 antibody, catalog no. 70R-9107
Purezza:Min. 95%RNASE1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RNASE1 antibody, catalog no. 70R-7107
Purezza:Min. 95%Ref: 3D-PP43285
Prodotto fuori produzioneEXT2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EXT2 antibody, catalog no. 70R-5708
Purezza:Min. 95%RIPX Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RIPX antibody, catalog no. 70R-8029
Purezza:Min. 95%C17ORF48 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C17orf48 antibody, catalog no. 70R-3640
Purezza:Min. 95%PI4KB Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PI4KB antibody, catalog no. 70R-3375
Purezza:Min. 95%FAM14A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM14A antibody, catalog no. 70R-7357
Purezza:Min. 95%GPR56 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GPR56 antibody, catalog no. 70R-7463Purezza:Min. 95%CLN6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CLN6 antibody, catalog no. 70R-6557
Purezza:Min. 95%BD 3 Human
BD 3 Human is a recombinant cytokine that has been shown to have a spectrum of activity against gram-positive and gram-negative bacteria, as well as yeast. BD 3 Human is produced by recombinant DNA technology and encodes the amino acid sequence of human interleukin-1 beta (IL-1β). It is a member of the IL-1 family, which includes IL-1α, IL-1β, IL-18, and IL-33. The molecular mass of BD 3 Human is 18 kDa. Cytokines are proteins that regulate cellular activities in response to stimuli from other cells or from the extracellular environment. Recombinant cytokines are produced by microorganisms or cells into which recombinant DNA has been introduced. They are used for research purposes, but not for diagnostic purposes or other therapeutic applications. Reconstitute with sterile water for injection before use. Reconstituted solutions may be stored at 2°C to 8°C
Purezza:Min. 95%H-AKAKSR-OH
Peptide H-AKAKSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PA00047
Prodotto fuori produzioneH-MEVGWYRPPFSRVVHLYRNGK-OH
MOG(35-55) human corresponds to amino acids 35 to 55 of the human myelin oligodendrocyte glycoprotein (MOG). It can be used in multiple sclerosis research to induce experimental autoimmune encephalomyelitis (EAE) in mouse and rat models.
Ref: 3D-PP46795
Prodotto fuori produzioneMAL-dPEG®36-TFP Ester
MAL-dPEG®36-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®36-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Formula:C25H35F4NO7S2Purezza:Min. 95%Peso molecolare:601.67 g/molParathyroid Hormone (Human, 1-84)
PTH is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications and is available as a 20µg vial.
Formula:C408H674N126O126S2Purezza:Min. 95%Peso molecolare:9,424.6 g/molGalanin-like Peptide (Human, 1-60)
Galanin-like peptide (GLP-1) is a human peptide that is a potent activator of the GLP-1 receptor. GLP-1 functions as a ligand for the GLP-1 receptor, which is coupled to G proteins. The activation of this receptor leads to increased calcium influx, which in turn triggers the release of insulin from pancreatic beta cells. GLP-1 also inhibits gastric acid secretion and motility, and functions as an inhibitor of glucagon secretion.
GLP-1 has been shown to be a potent inhibitor of ion channels. It binds to Kv3 potassium channels and voltage gated sodium channels, inhibiting their activity by binding to their pore region. In addition, GLP-1 inhibits amyloid beta production by inhibiting protein synthesis in rat brain cells.Formula:C292H451N83O84SPurezza:Min. 95%Peso molecolare:6,500.3 g/molRelaxin H2 (human) trifluoroacetate salt
CAS:Relaxin H2 is a hormone that is produced in the ovaries and has significant interactions with cyclase. It has been shown to bind to the receptor for relaxin and inhibit its activity. Relaxin H2 has been shown to be a potent inhibitor of cardiac growth factor-β1, which may contribute to its anti-fibrotic effects. This drug is also an inhibitor of fatty acid synthesis and can lead to metabolic disorders, such as glomerular filtration rate, by inhibiting the production of natriuretic peptide levels.
Formula:C256H408N74O74S8Purezza:Min. 95%Peso molecolare:5,962.95 g/molRef: 3D-FR109973
Prodotto fuori produzioneFK-506 (Tacrolimus)
CAS:FK-506 is an immunosuppressant that is produced by fermentation. It is used to prevent the rejection of transplanted organs and to treat a number of autoimmune diseases, including rheumatoid arthritis and multiple sclerosis. FK-506 binds to the IL-2 receptor on T-cells and inhibits their proliferation, thereby preventing activation of other immune cells. FK-506 has been shown to be effective in treating a number of diseases, including myocardial infarcts, coronary heart disease, and oral hypoglycaemic. The optimum concentration for this drug is not known, but it appears that higher concentrations are more beneficial in treating some conditions.
Formula:C44H69NO12Purezza:Min. 95%Peso molecolare:804 g/molRef: 3D-INT-3098-PI
Prodotto fuori produzioneObestatin (Rat, Mouse)
CAS:Obestatin is a peptide that was originally isolated from rat and mouse brain. It is a potent inhibitor of Kv1.3 and Kv1.5 potassium channels, with an IC50 of about 1 nM for both channels, but has no effect on other ion channels. Obestatin also inhibits the binding of antibodies to epitopes on the surface of cells, which may be due to its ability to inhibit cell-cell adhesion. The antibody-binding activity of obestatin is also inhibited by peptides corresponding to residues in the N-terminal region of obestatin, but not by peptides corresponding to residues in the C-terminal region. Obestatin has been shown to activate receptor tyrosine kinase (RTK) pathways and induce signaling cascades that lead to the proliferation and differentiation of tumor cells.
Formula:C114H174N34O31Purezza:Min. 95%Peso molecolare:2,516.8 g/molZ-Arg-Arg-AMC
CAS:Z-Arg-Arg-AMC is an activator of the receptor tyrosine kinase (RTK) system. It binds to the extracellular domain of RTKs, such as epidermal growth factor receptors (EGFR) and fibroblast growth factor receptors (FGFR), and activates these receptors. This compound has been shown to activate EGFR and FGFR at low concentrations and inhibit their activation at high concentrations. Z-Arg-Arg-AMC has also been shown to be a potent inhibitor of protein interactions with a Kd of approximately 1 μM, which makes it a useful research tool for studying protein interactions.
Formula:C30H39N9O6Purezza:Min. 95%Peso molecolare:621.69 g/molAngiotensin A
CAS:Angiotensin A is a research tool that is used to study the activation of angiotensin receptors. It can be used to identify ligands and receptors and to investigate the pharmacology of peptides. Angiotensin A is soluble (1-2 mg/ml) in water, dimethyl sulfoxide (DMSO), and phosphate buffered saline. It has a CAS number of 51833-76-2.
Formula:C49H71N13O10Purezza:Min. 95%Peso molecolare:1,002.2 g/molSNIP1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SNIP1 antibody, catalog no. 70R-7996
Purezza:Min. 95%Myosin Ic Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MYO1C antibody, catalog no. 70R-2182Purezza:Min. 95%ZNF366 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF366 antibody, catalog no. 70R-8434
Purezza:Min. 95%LRRC8A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC8A antibody, catalog no. 70R-6449
Purezza:Min. 95%SF3B4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SF3B4 antibody, catalog no. 70R-1408
Purezza:Min. 95%PPIL2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PPIL2 antibody, catalog no. 70R-2369
Purezza:Min. 95%C6ORF21 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C6orf21 antibody, catalog no. 70R-6411
Purezza:Min. 95%NSUN6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NSUN6 antibody, catalog no. 70R-4984
Purezza:Min. 95%Morf4l1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Morf4l1 antibody, catalog no. 70R-8723
Purezza:Min. 95%MBD3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MBD3 antibody, catalog no. 70R-2026
Purezza:Min. 95%ODF3L1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ODF3L1 antibody, catalog no. 70R-3318
Purezza:Min. 95%RCAN3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RCAN3 antibody, catalog no. 70R-5883
Purezza:Min. 95%MAGEB3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEB3 antibody, catalog no. 70R-3893
Purezza:Min. 95%SP6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SP6 antibody, catalog no. 70R-9024
Purezza:Min. 95%COL8A2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of COL8A2 antibody, catalog no. 70R-9965
Purezza:Min. 95%ROM1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ROM1 antibody, catalog no. 70R-6107
Purezza:Min. 95%SRRM4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SRRM4 antibody, catalog no. 70R-10054
Purezza:Min. 95%CAMKV Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CAMKV antibody, catalog no. 70R-3638
Purezza:Min. 95%A1CF Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of A1CF antibody, catalog no. 70R-4765
Purezza:Min. 95%Ccdc90b Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Ccdc90b antibody, catalog no. 70R-8824
Purezza:Min. 95%RCC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RCC1 antibody, catalog no. 70R-10289
Purezza:Min. 95%ERGIC3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ERGIC3 antibody, catalog no. 70R-6447
Purezza:Min. 95%GTPBP2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GTPBP2 antibody, catalog no. 70R-3865
Purezza:Min. 95%CACNB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CACNB2 antibody, catalog no. 70R-5076
Purezza:Min. 95%DGKH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DGKH antibody, catalog no. 70R-5760
Purezza:Min. 95%IRX3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IRX3 antibody, catalog no. 20R-1124
Purezza:Min. 95%ACTA1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACTA1 antibody, catalog no. 70R-10210
Purezza:Min. 95%PWWP2A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PWWP2A antibody, catalog no. 70R-2966
Purezza:Min. 95%SPINK6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SPINK6 antibody, catalog no. 70R-9366
Purezza:Min. 95%TMEM176A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM176A antibody, catalog no. 70R-6936
Purezza:Min. 95%MAGEA5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAGEA5 antibody, catalog no. 70R-4559
Purezza:Min. 95%CORIN Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CORIN antibody, catalog no. 70R-1759
Purezza:Min. 95%FECH Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FECH antibody, catalog no. 70R-2666
Purezza:Min. 95%GCOM1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Gcom1 antibody, catalog no. 70R-3275
Purezza:Min. 95%AP2A2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of AP2A2 antibody, catalog no. 70R-9954
Purezza:Min. 95%INPP5B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of INPP5B antibody, catalog no. 70R-2472
Purezza:Min. 95%GCET2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GCET2 antibody, catalog no. 70R-2354
Purezza:Min. 95%KIAA0182 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0182 antibody, catalog no. 70R-4413
Purezza:Min. 95%RABEPK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RABEPK antibody, catalog no. 70R-4502
Purezza:Min. 95%LRRC37B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC37B antibody, catalog no. 70R-6920
Purezza:Min. 95%FAM156A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM156A antibody, catalog no. 70R-4820
Purezza:Min. 95%APOL5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of APOL5 antibody, catalog no. 70R-9610
Purezza:Min. 95%NPM2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NPM2 antibody, catalog no. 70R-5531
Purezza:Min. 95%RGS22 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RGS22 antibody, catalog no. 70R-3489
Purezza:Min. 95%CYP4B1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CYP4B1 antibody, catalog no. 70R-7503
Purezza:Min. 95%EIF2C3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF2C3 antibody, catalog no. 70R-2539
Purezza:Min. 95%NTNG2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NTNG2 antibody, catalog no. 70R-10047
Purezza:Min. 95%Astrotactin 2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ASTN2 antibody, catalog no. 70R-6099
Purezza:Min. 95%OR2T29 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of OR2T29 antibody, catalog no. 70R-9905
Purezza:Min. 95%RABEPK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RABEPK antibody, catalog no. 70R-4503
Purezza:Min. 95%NSUN5C Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NSUN5C antibody, catalog no. 70R-1208
Purezza:Min. 95%DDX23 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DDX23 antibody, catalog no. 70R-1383
Purezza:Min. 95%SYTL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SYTL1 antibody, catalog no. 70R-10154
Purezza:Min. 95%NSUN4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NSUN4 antibody, catalog no. 70R-2977
Purezza:Min. 95%HNRPUL1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPUL1 antibody, catalog no. 70R-4684
Purezza:Min. 95%NLGN4X Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NLGN4X antibody, catalog no. 70R-6163
Purezza:Min. 95%ME3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ME3 antibody, catalog no. 70R-2502
Purezza:Min. 95%CPEB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CPEB2 antibody, catalog no. 70R-1357
Purezza:Min. 95%SIGLEC6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC6 antibody, catalog no. 70R-6185
Purezza:Min. 95%FZD10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FZD10 antibody, catalog no. 70R-7226
Purezza:Min. 95%PDE7B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PDE7B antibody, catalog no. 70R-2093
Purezza:Min. 95%ZER1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZER1 antibody, catalog no. 70R-9767
Purezza:Min. 95%ZIC1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZIC1 antibody, catalog no. 70R-7992
ACVR1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ACVR1 antibody, catalog no. 70R-7319
Purezza:Min. 95%TRIM58 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TRIM58 antibody, catalog no. 70R-9574
Purezza:Min. 95%beta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Formula:C28H45N7O9Peso molecolare:623.71 g/molRef: 3D-VAC-00890
Prodotto fuori produzione[Pyr6]-Substance P (6-11)
Catalogue peptide; min. 95% purity
Formula:C36H49N7O7SPeso molecolare:723.91 g/molRef: 3D-VAC-00172
Prodotto fuori produzione[Tyr8,Nle11] Substance P
Catalogue peptide; min. 95% purity
Formula:C64H100N18O14Peso molecolare:1,345.62 g/molRef: 3D-VAC-00677
Prodotto fuori produzioneH-D-Phe-pip-Arg-pna acetate
CAS:H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Formula:C27H36N8O5Purezza:Min. 95%Peso molecolare:552.6 g/molBiotin-Neuromedin S (rat)
Catalogue peptide; min. 95% purity
Formula:C67H87N15O14Peso molecolare:1,326.53 g/molRef: 3D-VAC-00102
Prodotto fuori produzione[Arg0] Met-Enkephalin
Catalogue peptide; min. 95% purity
Formula:C33H47N9O8SPeso molecolare:729.86 g/molRef: 3D-VAC-00699
Prodotto fuori produzioneSH2 Domain Ligand (4)
Catalogue peptide; min. 95% purity
Formula:C40H51N5O18P2Peso molecolare:951.86 g/molRef: 3D-VAC-00020
Prodotto fuori produzioneDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formula:C66H117N23O13Peso molecolare:1,440.81 g/molRef: 3D-VAC-00416
Prodotto fuori produzioneAc-Choline Receptor α1(129-145)
Catalogue peptide; min. 95% purity
Formula:C90H136N22O28S2Peso molecolare:2,038.34 g/molRef: 3D-VAC-00367
Prodotto fuori produzioneRef: 3D-VAC-00183
Prodotto fuori produzioneα-Neo-Endorphin Analog
Catalogue peptide; min. 95% purity
Formula:C66H102N20O13Peso molecolare:1,383.68 g/molRef: 3D-VAC-00869
Prodotto fuori produzioneRef: 3D-VAC-00717
Prodotto fuori produzioneLys-(Tyr8)-Bradykinin
Catalogue peptide; min. 95% purity
Formula:C56H85N17O13Peso molecolare:1,204.41 g/molRef: 3D-VAC-00551
Prodotto fuori produzioneFluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C41H43FN4O14Purezza:Min. 95%Peso molecolare:834.8 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Ref: 3D-FF111724
Prodotto fuori produzioneGrowth Hormone Releasing Factor, GRF (1-40), amide, human
Catalogue peptide; min. 95% purity
Formula:C194H318N62O62SPeso molecolare:4,543.14 g/molRef: 3D-VAC-00847
Prodotto fuori produzioneRef: 3D-VAC-00563
Prodotto fuori produzione[Ala2] Met-Enkephalin, amide
Catalogue peptide; min. 95% purity
Formula:C28H38N6O6SPeso molecolare:586.72 g/molRef: 3D-VAC-00854
Prodotto fuori produzioneCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purezza:Min. 95%Ref: 3D-BC183139
Prodotto fuori produzione[Gln22]-25359-Amyloid (6-40)
Catalogue peptide; min. 95% purity
Formula:C167H258N46O48SPeso molecolare:3,710.26 g/molRef: 3D-VAC-00470
Prodotto fuori produzioneAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Formula:C173H273N49O52S2Peso molecolare:3,935.55 g/molRef: 3D-VAC-00168
Prodotto fuori produzioneBiotin-ACTH (1-39), human
Catalogue peptide; min. 95% purity
Formula:C217H322N58O60SPeso molecolare:4,767.47 g/molRef: 3D-VAC-00119
Prodotto fuori produzione[Phe22] Big Endothelin-1 (19-37), human
Catalogue peptide; min. 95% purity
Formula:C104H152N26O26Peso molecolare:2,182.53 g/molRef: 3D-VAC-00505
Prodotto fuori produzione[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Formula:C145H210N42O45Peso molecolare:3,261.54 g/molRef: 3D-VAC-00315
Prodotto fuori produzioneBiotin-Glucagon (1-29), bovine, human, porcine
Catalogue peptide; min. 95% purity
Formula:C163H239N45O51S2Peso molecolare:3,709.03 g/molRef: 3D-VAC-00100
Prodotto fuori produzioneAmyloid beta-Protein (6-20)
Catalogue peptide; min. 95% purity
Formula:C86H119N23O23Peso molecolare:1,843.05 g/molRef: 3D-VAC-00471
Prodotto fuori produzioneAngiotensin II Substrate
Catalogue peptide; min. 95% purity
Formula:C50H72N13O15PPeso molecolare:1,126.20 g/molRef: 3D-VAC-00342
Prodotto fuori produzioneNTB (Naltriben)
Catalogue peptide; min. 95% purity
Formula:C50H65N11O11S2Peso molecolare:1,060.29 g/molRef: 3D-VAC-00140
Prodotto fuori produzioneAF-16 trifluoroacetate salt
CAS:AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.Formula:C71H119N25O25SPurezza:Min. 95%Peso molecolare:1,754.92 g/molDok-6 (263-275)
Catalogue peptide; min. 95% purity
Formula:C76H113N25O18Peso molecolare:1,664.90 g/molRef: 3D-VAC-00578
Prodotto fuori produzioneTryptophan Motif Peptide
Catalogue peptide; min. 95% purity
Formula:C35H41N11O7Peso molecolare:727.79 g/molRef: 3D-VAC-00424
Prodotto fuori produzioneCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Formula:C124H205N39O39S2Peso molecolare:2,930.38 g/molRef: 3D-VAC-00514
Prodotto fuori produzioneTyr-Leptin (26-39) (human)
CAS:Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C80H137N19O25Purezza:Min. 95%Peso molecolare:1,765.06 g/molRef: 3D-FT109022
Prodotto fuori produzioneγ-TAC4 (30-61)-NH2
Catalogue peptide; min. 95% purity
Formula:C155H242N40O49SPeso molecolare:3,481.96 g/molRef: 3D-VAC-00760
Prodotto fuori produzioneα-Mating Factor (1-6)
Catalogue peptide; min. 95% purity
Formula:C45H59N11O8Peso molecolare:882.04 g/molRef: 3D-VAC-00818
Prodotto fuori produzioneH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Formula:C28H53N7O8Purezza:Min. 95%Peso molecolare:615.76 g/molRef: 3D-FS108741
Prodotto fuori produzione(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C57H72N14O8Purezza:Min. 95%Peso molecolare:1,081.27 g/molBoc-Lys(Tfa)-AMC
CAS:Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.
Formula:C23H28F3N3O6Purezza:Min. 95%Peso molecolare:499.48 g/molTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Formula:C79H120N18O21Peso molecolare:1,657.95 g/molRef: 3D-VAC-00651
Prodotto fuori produzioneSomatostatin-28 (1-14)
Catalogue peptide; min. 95% purity
Formula:C61H105N23O21SPeso molecolare:1,528.72 g/molRef: 3D-VAC-00704
Prodotto fuori produzioneDok-4 (263-275)
Catalogue peptide; min. 95% purity
Formula:C70H101N21O18Peso molecolare:1,524.72 g/molRef: 3D-VAC-00577
Prodotto fuori produzione[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formula:C216H343N67O60Peso molecolare:4,838.43 g/molRef: 3D-VAC-00857
Prodotto fuori produzioneNps-Val-OH·DCHA
CAS:Prodotto controllatoPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C11H14N2O4S·C12H23NPurezza:Min. 95%Peso molecolare:451.62 g/molRef: 3D-FN107891
Prodotto fuori produzioneTachykinin (111-129) Beta-Prepro (Human)
Catalogue peptide; min. 95% purity
Formula:C96H156N34O31SPeso molecolare:2,314.59 g/molRef: 3D-VAC-00234
Prodotto fuori produzioneSubstance P reversed sequence
Catalogue peptide; min. 95% purity
Formula:C63H98N18O13SPeso molecolare:1,347.66 g/molRef: 3D-VAC-00604
Prodotto fuori produzioneKinase Domain of Insulin Receptor (3)
Catalogue peptide; min. 95% purity
Formula:C72H108N19O27Peso molecolare:1,702.77 g/molRef: 3D-VAC-00772
Prodotto fuori produzioneProlactin Releasing Peptide (12-31), bovine
Catalogue peptide; min. 95% purity
Formula:C103H156N32O25Peso molecolare:2,242.59 g/molRef: 3D-VAC-00767
Prodotto fuori produzioneADP-Ribosylation Factor 6, ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formula:C60H102N16O17Peso molecolare:1,319.58 g/molRef: 3D-VAC-00433
Prodotto fuori produzioneRef: 3D-VAC-00194
Prodotto fuori produzioneHypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formula:C180H287N57O48Peso molecolare:4,017.55 g/molRef: 3D-VAC-00260
Prodotto fuori produzioneParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Formula:C151H211N37O39SPeso molecolare:3,199.65 g/molRef: 3D-VAC-00276
Prodotto fuori produzioneRef: 3D-VAC-00724
Prodotto fuori produzioneAmyloid beta-Protein (25-35) amide
Catalogue peptide; min. 95% purity
Formula:C45H82N14O13SPeso molecolare:1,059.31 g/molRef: 3D-VAC-00452
Prodotto fuori produzioneZ-Ile-Glu(OtBu)-Ala-Leu-aldehyde
CAS:Z-Ile-Glu(OtBu)-Ala-Leu-aldehyde, also known as ZILEAL, is a potent immunosuppressant that binds to the Toll-like receptor (TLR) and inhibits NF-κB binding activity. It has been shown to reduce the activation of macrophages by inhibiting the production of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα), IL-1β, and IL-6. This drug has been shown to inhibit HIV replication in vitro and was also found to have an antiviral effect against herpes simplex virus type 1 in vivo. ZILEAL also inhibits dsDNA binding activity, which may have potential applications in cancer treatment.
Formula:C32H50N4O8Purezza:Min. 95%Peso molecolare:618.76 g/molRef: 3D-FI111570
Prodotto fuori produzioneP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Formula:C33H45N6O12PPeso molecolare:748.8 g/molRef: 3D-VAC-00034
Prodotto fuori produzioneAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Formula:C264H406N80O77S3Peso molecolare:6,028.72 g/molRef: 3D-VAC-00919
Prodotto fuori produzioneBiotin-Angiotensin I, human
Catalogue peptide; min. 95% purity
Formula:C72H103N19O16SPeso molecolare:1,522.81 g/molRef: 3D-VAC-00084
Prodotto fuori produzioneCecropin A (1-7)-Melittin A (2-9) amide
Catalogue peptide; min. 95% purity
Formula:C89H152N22O15Peso molecolare:1,770.34 g/molRef: 3D-VAC-00558
Prodotto fuori produzioneH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ref: 3D-PP47266
Prodotto fuori produzioneRef: 3D-VAC-00639
Prodotto fuori produzioneSALMF amide 2 (S2)
Catalogue peptide; min. 95% purity
Formula:C59H82N14O18Peso molecolare:1,275.4 g/molRef: 3D-VAC-00720
Prodotto fuori produzione
![[Pyr6]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00172.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
![[Arg0] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00699.webp&w=3840&q=75)
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[Gln22]-25359-Amyloid (6-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00470.webp&w=3840&q=75)
![[Phe22] Big Endothelin-1 (19-37), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00505.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
