
Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30473 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Endokinin A/B
<p>Catalogue peptide; min. 95% purity</p>Formula:C50H77N13O12SPeso molecolare:1,084.32 g/mol[D-Ala2,DPro4,Tyr5]-β-Casomorphin (1-5), amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C35H42N6O7Peso molecolare:658.8 g/molIntermedin-53 (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C247H397N83O73S3Peso molecolare:5,793.61 g/molADR1-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C65H114N22O18Peso molecolare:1,491.77 g/molα-Helical CRF (9-41)
<p>Catalogue peptide; min. 95% purity</p>Formula:C166H274N46O53S2Peso molecolare:3,826.44 g/molPLM derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C49H96N24O12Peso molecolare:1,213.47 g/molFas C-Terminal Tripeptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C16H29N3O6Peso molecolare:359.43 g/molp3K truncated, (Lys 58 Lys 60 Lys 63) Ea(54-68)
<p>Catalogue peptide; min. 95% purity</p>Formula:C59H97N17O19Peso molecolare:1,348.53 g/molAc-g-Endorphin
<p>Catalogue peptide; min. 95% purity</p>Formula:C85H133N19O28SPeso molecolare:1,901.18 g/mol[Ala18] Endothelin-1, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C108H163N25O30S5Peso molecolare:2,451.94 g/molα-CGRP (23-37) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C74H117N21O20Peso molecolare:1,620.89 g/molPACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
CAS:<p>Catalogue peptide; min. 95% purity</p>Formula:C121H193N33O30SPeso molecolare:2,638.15 g/molSALMF amide 1 (S1)
<p>Catalogue peptide; min. 95% purity</p>Formula:C41H60N10O10SPeso molecolare:885.1 g/molBiotin-Obestatin (rat)
<p>Catalogue peptide; min. 95% purity</p>Formula:C124H188N36O33Peso molecolare:2,743.17 g/molR-G-D-S-P-A-S-S-K-P
<p>Catalogue peptide; min. 95% purity</p>Formula:C40H68N14O16Peso molecolare:1,001.07 g/molAmyloid Bri Protein (1-34)
<p>Catalogue peptide; min. 95% purity</p>Formula:C173H273N49O52S2Peso molecolare:3,935.55 g/molAtrial Natriuretic Factor (4-28) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C112H175N39O35S3Peso molecolare:2,724.02 g/molSelectin
<p>Catalogue peptide; min. 95% purity</p>Formula:C62H105N16O18S2Peso molecolare:1,426.75 g/molCecropin A (1-7)-Melittin A (2-9) amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C89H152N22O15Peso molecolare:1,770.34 g/molBiotin-Angiotensin I, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C72H103N19O16SPeso molecolare:1,522.81 g/molAmyloid β-Protein (25-35) amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C45H82N14O13SPeso molecolare:1,059.31 g/molα-Conotoxin MI
<p>Catalogue peptide; min. 95% purity</p>Formula:C58H92N22O17S4Peso molecolare:1,497.74 g/molβ-Endorphin (1-26), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C130H208N32O38SPeso molecolare:2,859.36 g/molRSK Substrate, S6 (231-239)
<p>Catalogue peptide; min. 95% purity</p>Formula:C45H88N22O11Peso molecolare:1,113.34 g/mol[D-Ala2]-β-Casomorphin (1-4) amide (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formula:C26H33N5O5Peso molecolare:495.58 g/molCDPKS, Syntide analog
<p>Catalogue peptide; min. 95% purity</p>Formula:C47H86N16O13Peso molecolare:1,083.31 g/molHypercalcemia Malignancy Factor (1-40)
<p>Catalogue peptide; min. 95% purity</p>Formula:C180H287N57O48Peso molecolare:4,017.55 g/molBiotin-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Formula:C86H118N20O21S3Peso molecolare:1,864.21 g/molDynorphin A (8-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C59H96N18O15Peso molecolare:1,297.53 g/mol[D-Ala2] Met-Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Formula:C28H37N5O7SPeso molecolare:587.70 g/molADP-Ribosylation Factor 6, ARF6 (2-13)
<p>Catalogue peptide; min. 95% purity</p>Formula:C60H102N16O17Peso molecolare:1,319.58 g/molHelodormin
<p>Catalogue peptide; min. 95% purity</p>Formula:C176H285N47O49Peso molecolare:3,843.47 g/molCaspase 2 Substrate 1m (ICH-1), fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formula:C33H44N6O12Peso molecolare:716.8 g/molBiotin-LC-Protein Kinase G Substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C69H121N25O18SPeso molecolare:1,621 g/molAc-a-CGRP (19-37) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C88H139N25O26Peso molecolare:1,963.24 g/molPreprogalanin 28-67, rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C198H312N62O58Peso molecolare:4,488.96 g/molβ-Amyloid (13-27)
<p>Catalogue peptide; min. 95% purity</p>Formula:C84H126N24O24Peso molecolare:1,856.09 g/molBiotin-Obestatin (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C126H190N34O35Peso molecolare:2,773.19 g/molBiotin-a-CGRP (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C173H281N53O51S2Peso molecolare:4,015.69 g/molβ-Amyloid Protein Precursor (657-676)
<p>Catalogue peptide; min. 95% purity</p>Formula:C95H152N30O31Peso molecolare:2,210.45 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formula:C164H278N58O45S4Peso molecolare:3,910.64 g/molSarafotoxin S6d
<p>Catalogue peptide; min. 95% purity</p>Formula:C112H167N27O34S5Peso molecolare:2,596 g/molEndothelin-1 (1-15), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C70H108N16O24S5Peso molecolare:1,718.02 g/molAngiotensinogen (1-13)
<p>Catalogue peptide; min. 95% purity</p>Formula:C79H116N22O17Peso molecolare:1,645.9 g/molInterleukin II (60-70)
<p>Catalogue peptide; min. 95% purity</p>Formula:C68H104N14O14SPeso molecolare:1,373.74 g/molProlactin Releasing Peptide (12-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Formula:C103H156N32O25Peso molecolare:2,242.59 g/mol4A/4B, Peptide (1)
<p>Catalogue peptide; min. 95% purity</p>Formula:C67H100N16O25S2Peso molecolare:1,593.76 g/molKinase Domain of Insulin Receptor (3)
<p>Catalogue peptide; min. 95% purity</p>Formula:C72H108N19O27Peso molecolare:1,702.77 g/molSubstance P reversed sequence
<p>Catalogue peptide; min. 95% purity</p>Formula:C63H98N18O13SPeso molecolare:1,347.66 g/molTachykinin (111-129) β-Prepro (Human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C96H156N34O31SPeso molecolare:2,314.59 g/molGPC3 (298-306), mouse
<p>Catalogue peptide; min. 95% purity</p>Formula:C51H81N9O18Peso molecolare:1,108.26 g/mol[Phe7] Dynorphin A (1-7), amide, porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C43H59N11O8Peso molecolare:858.02 g/molLL-37 pentamide
<p>Catalogue peptide; min. 95% purity</p>Formula:C208H343N65O48Peso molecolare:4,522.46 g/molpp60 C-SRC Carboxy-Terminal Phosphoregulatory Peptide Phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Formula:C62H95N16O28PPeso molecolare:1,543.53 g/molCys-Gly-His-Gly-Asn-Lys-Ser-Amyloid β-Protein (33-40)
<p>Catalogue peptide; min. 95% purity</p>Formula:C58H99N19O18S2Peso molecolare:1,414.67 g/molAntho-Rwamide II
<p>Catalogue peptide; min. 95% purity</p>Formula:C30H44N10O6Peso molecolare:640.79 g/molEpidermal Mitosis Inhibiting Pentapeptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C19H27N5O12Peso molecolare:517.45 g/molTryptophan Motif Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C35H41N11O7Peso molecolare:727.79 g/mol[Pyr5]-Substance P (5-11)
<p>Catalogue peptide; min. 95% purity</p>Formula:C41H57N9O9SPeso molecolare:852.05 g/mol[D-Phe11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Formula:C78H121N21O19Peso molecolare:1,657 g/molProlactin Releasing Peptide (12-31), rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C104H158N32O26Peso molecolare:2,272.62 g/molAmyloid β-Protein (20-29)
<p>Catalogue peptide; min. 95% purity</p>Formula:C43H66N12O17Peso molecolare:1,023.08 g/mol[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) ((Ala286)-CaMK-II (281-302))
<p>Catalogue peptide; min. 95% purity</p>Formula:C111H191N39O29S2Peso molecolare:2,600.07 g/molHPV-E6-C
<p>Catalogue peptide; min. 95% purity</p>Formula:C110H178N36O30SPeso molecolare:2,516.92 g/molGRF (free acid) (human)
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H357N71O67SPeso molecolare:5,040.74 g/molAmyloid β-Protein (33-42)
<p>Catalogue peptide; min. 95% purity</p>Formula:C41H74N10O11SPeso molecolare:915.17 g/mol[Arg8]-a-Neo-Endorphin (1-8)
<p>Catalogue peptide; min. 95% purity</p>Formula:C46H73N15O10Peso molecolare:996.19 g/molBiotin-a-CGRP (canine, mouse, rat)
<p>Catalogue peptide; min. 95% purity</p>Formula:C172H276N52O54S3Peso molecolare:4,032.63 g/molAngiotensin II (1-4), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C24H37N7O8Peso molecolare:551.6 g/mol[D-Lys3]-GHRP-6
<p>Catalogue peptide; min. 95% purity</p>Formula:C49H63N13O6Peso molecolare:930.13 g/molNecrofibrin, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C67H112N16O25Peso molecolare:1,541.73 g/molPancreatic Polypeptide (31-36) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C36H61N13O8Peso molecolare:804 g/molPT-141
<p>TFA salt. Catalogue peptide; min. 95% purity</p>Formula:C50H68N14O10Peso molecolare:1,025.20 g/molTransforming Growth Factor β1 Peptide, TGF-β1 (60-66), amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C45H78N12O10Peso molecolare:947.20 g/molLys-Bradykinin-Ser-Val-Gln-Val-Ser
<p>Catalogue peptide; min. 95% purity</p>Formula:C77H121N23O20Peso molecolare:1,688.96 g/molIL-1b (208-240) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C191H292N48O51SPeso molecolare:4,108.81 g/mol[Val5,Asn9]-Angiotensin I
<p>Catalogue peptide; min. 95% purity</p>Formula:C59H86N16O15Peso molecolare:1,259.44 g/molC-terminal Proghrelin Isoform Peptide, mouse
<p>Catalogue peptide; min. 95% purity</p>Formula:C50H86N22O17Peso molecolare:1,267.38 g/molPrepro-adrenomedullin (153-185), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C143H224N42O43Peso molecolare:3,219.56 g/molMyosin Kinase Inhibiting Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C40H78N18O11Peso molecolare:987.2 g/molSalusin-α
<p>Catalogue peptide; min. 95% purity</p>Formula:C114H192N40O30Peso molecolare:2,602.99 g/molBiotin-Kinase Domain of Insulin Receptor (2)
<p>Catalogue peptide; min. 95% purity</p>Formula:C72H122N21O29SPeso molecolare:1,777.92 g/molHPV-E7-C
<p>Catalogue peptide; min. 95% purity</p>Formula:C83H128N24O40Peso molecolare:2,102.04 g/molAGRP (54-82)
<p>Catalogue peptide; min. 95% purity</p>Formula:C137H225N39O54Peso molecolare:3,282.47 g/molSomatostatin-14 (3-10)
<p>Catalogue peptide; min. 95% purity</p>Formula:C52H72N12O11SPeso molecolare:1,073.28 g/molMSH Release Inhibiting Factor, amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C13H24N4O3Peso molecolare:284.36 g/molNps-Lys(Boc)-OH·DCHA
CAS:Prodotto controllato<p>Please enquire for more information about Nps-Lys(Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C17H25N3O6S·C12H23NPurezza:Min. 95%Peso molecolare:580.78 g/molβ-Casein (90-96)
<p>Catalogue peptide; min. 95% purity</p>Formula:C103H175N35O27SPeso molecolare:2,367.83 g/mol[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C143H226N46O39Peso molecolare:3,213.6 g/molPre-S1 (12-32)
<p>Catalogue peptide; min. 95% purity</p>Formula:C104H154N26O31SPeso molecolare:2,296.61 g/molH-SIYRYYGL-OH
<p>Peptide H-SIYRYYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Forkhead derived peptide, Woodtide
<p>Catalogue peptide; min. 95% purity</p>Formula:C68H123N21O20SPeso molecolare:1,586.93 g/molSMCX (963-973) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C48H81N13O18Peso molecolare:1,128.26 g/mol[Pyr6]-Substance P (6-11)
<p>Catalogue peptide; min. 95% purity</p>Formula:C36H49N7O7SPeso molecolare:723.91 g/molTax8, HTLV-1 (12-19)
<p>Catalogue peptide; min. 95% purity</p>Formula:C50H68N8O11Peso molecolare:957.15 g/molSH2 Domain Ligand (5)
<p>Catalogue peptide; min. 95% purity</p>Formula:C41H62N7O16PSPeso molecolare:972.05 g/molβ-Amyloid (16-26)
<p>Catalogue peptide; min. 95% purity</p>Formula:C57H86N12O17Peso molecolare:1,211.39 g/molAc-Hirudin (55-65) (desulfated)
<p>Catalogue peptide; min. 95% purity</p>Formula:C66H92N12O25Peso molecolare:1,453.53 g/molDendroaspis Natriuretic Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C180H282N56O56S2Peso molecolare:4,190.72 g/molPKA Inhibitor Substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C61H108N25O22PPeso molecolare:1,574.69 g/molVIP (1-12), human, porcine, rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C61H88N18O22Peso molecolare:1,425.49 g/mol[Arg91, Ala96]-MBP (87-99), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C72H112N22O17Peso molecolare:1,557.83 g/molExendin 4 (3-39)
<p>Catalogue peptide; min. 95% purity</p>Formula:C176H271N46O58S1Peso molecolare:3,991.36 g/molBiotin-Insulin Receptor (1142-1153)
<p>Catalogue peptide; min. 95% purity</p>Formula:C82H121N21O26Peso molecolare:1,849.07 g/molTNF-α (46-65) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C110H172N24O30Peso molecolare:2,310.74 g/molβ-Endorphin (27-31) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C28H45N7O9Peso molecolare:623.71 g/molNTB (Naltriben)
<p>Catalogue peptide; min. 95% purity</p>Formula:C50H65N11O11S2Peso molecolare:1,060.29 g/molβ-Amyloid (31-35)
<p>Catalogue peptide; min. 95% purity</p>Formula:C25H47N5O6SPeso molecolare:545.75 g/mol[D-Phe7, D-Trp10]-Somatostatin 14 (7-14)
<p>Catalogue peptide; min. 95% purity</p>Peso molecolare:1,049.3 g/molLeucokinin V
<p>Catalogue peptide; min. 95% purity</p>Formula:C35H46N10O11Peso molecolare:782.8 g/molXenopsin (XP)
<p>Catalogue peptide; min. 95% purity</p>Formula:C47H73N13O10Peso molecolare:980.20 g/molα-Conotoxin EI
<p>Catalogue peptide; min. 95% purity</p>Formula:C83H123N27O27S5Peso molecolare:2,091.39 g/molHPV-E7-N
<p>Catalogue peptide; min. 95% purity</p>Formula:C108H159N23O39S2Peso molecolare:2,467.72 g/molPDGFRtide
<p>Catalogue peptide; min. 95% purity</p>Formula:C54H76N10O20Peso molecolare:1,185.26 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
<p>Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MMP Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formula:C45H64N14O11Peso molecolare:977.1 g/molAdrenomedullin (1-52), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C264H406N80O77S3Peso molecolare:6,028.72 g/molMastoparan 7
<p>Catalogue peptide; min. 95% purity</p>Formula:C67H124N18O15Peso molecolare:1,421.85 g/molBrain Derived Acidic Fibroblast Growth Factor (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formula:C62H95N15O15Peso molecolare:1,290.53 g/molMLC-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C70H115N25O17Peso molecolare:1,578.85 g/molBiotin-Glucagon-Like Peptide 1 (7-36), amide, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C159H240N42O47Peso molecolare:3,524.00 g/mol[Lys(Me3)4]-Histone H3 (1-21), H3K4(Me3)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:2,296.6 g/molLMP1 (156-164), IAL
<p>Catalogue peptide; min. 95% purity</p>Formula:C55H81N13O14Peso molecolare:1,148.34 g/mol[Des-Tyr1]-g-Endorphin
<p>Catalogue peptide; min. 95% purity</p>Formula:C74H122N18O25SPeso molecolare:1,695.97 g/molRC-160(Vapreotide)
<p>Catalogue peptide; min. 95% purity</p>Formula:C57H70N12O9S2Peso molecolare:1,131.4 g/molP60c-src Substrate II, Phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Formula:C33H45N6O12PPeso molecolare:748.8 g/molMMP-7 Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formula:C52H77N17O14Peso molecolare:1,164.31 g/molBiotin-CRF (human, rat)
<p>Catalogue peptide; min. 95% purity</p>Formula:C218H358N62O65S3Peso molecolare:4,983.85 g/mol[Des-Tyr1]-β-Endorphin, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C149H242N38O44SPeso molecolare:3,301.88 g/molCalpain Inhibitor Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C140H227N35O44SPeso molecolare:3,136.64 g/molPKCe pseudosubstrate derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C83H155N39O21SPeso molecolare:2,067.47 g/molα-CGRP (19-37), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C86H137N25O25Peso molecolare:1,921.20 g/mol[D-Ala2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C28H38N6O6SPeso molecolare:586.72 g/molPAR-1-selective peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C35H58N10O9Peso molecolare:762.91 g/molβ-Bag Cell Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C33H53N13O6Peso molecolare:727.87 g/molα-Melanocyte Stimulating Hormone [Acetyl-D-Lys11, D-Val13] (11-13) (MSHa)
<p>Catalogue peptide; min. 95% purity</p>Formula:C18H33N5O4Peso molecolare:383.49 g/molPACAP-38, amide, frog
<p>Catalogue peptide; min. 95% purity</p>Formula:C204H333N63O53SPeso molecolare:4,548.38 g/molParallel topology β-Amyloid modified peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C151H211N37O39SPeso molecolare:3,199.65 g/molIL-8ra (9-29)
<p>Catalogue peptide; min. 95% purity</p>Formula:C112H150N24O38S2Peso molecolare:2,504.71 g/molAc-β-Endorphin, bovine, camel, ovine
<p>Catalogue peptide; min. 95% purity</p>Formula:C157H252N42O45SPeso molecolare:3,479.99 g/molKinase Domain of Insulin Receptor (2)
<p>Catalogue peptide; min. 95% purity</p>Formula:C72H108N19O27PPeso molecolare:1,702.77 g/molGLP-2 (1-33) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C165H254N44O55SPeso molecolare:3,766.1 g/molβ-Casomorphin (1-5) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formula:C30H37N5O7Peso molecolare:579.66 g/molp34cdc2-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C62H104N16O19Peso molecolare:1,377.62 g/molGalanin-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C155H237N46O46SPeso molecolare:3,511.95 g/molF1 Peptide, lobster
<p>Catalogue peptide; min. 95% purity</p>Formula:C48H75N17O11Peso molecolare:1,066.24 g/molIL-8 Inhibitor
CAS:<p>IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys-Arg-NH2 is a molecule that blocks the receptor for IL-8, a c-c chemokine. This leads to reduced inflammation and decreased activation of cells in the inflammatory process. IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys--Arg--NH2 has been shown to be effective in reducing chronic bronchitis and pancreatitis in animal models. The effective dose for IL 8 inhibitor is not yet known.</p>Formula:C45H66N18O7SPurezza:Min. 95%Peso molecolare:1,003.19 g/molMARCKS PSD-Derived Peptide, PKC Substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C75H122N20O15Peso molecolare:1,543.93 g/molDok-4 (263-275)
<p>Catalogue peptide; min. 95% purity</p>Formula:C70H101N21O18Peso molecolare:1,524.72 g/molProsaptide 769P
<p>Catalogue peptide; min. 95% purity</p>Formula:C114H194N28O35SPeso molecolare:2,548.98 g/mol[Tyr0] Gastric Inhibitory Peptide (23-42), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C119H182N34O31Peso molecolare:2,584.92 g/mol4A/4B, 5A/5B Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C49H73N11O22S3Peso molecolare:1,264.38 g/molMBP (90-106), phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Formula:C89H141N25O22Peso molecolare:1,913.27 g/molFmoc-Mating Factor a
<p>Catalogue peptide; min. 95% purity</p>Formula:C97H125N20O19SPeso molecolare:1,907.26 g/molCEA Related, QYSWFVNGTF
<p>Catalogue peptide; min. 95% purity</p>Formula:C61H77N13O16Peso molecolare:1,248.37 g/mol[Des-Leu26,Cys(Acm)20,31]-EGF (20-31)
<p>Catalogue peptide; min. 95% purity</p>Formula:C57H87N15O22S3Peso molecolare:1,430.61 g/molAntho-Rwamide I
<p>Catalogue peptide; min. 95% purity</p>Formula:C31H46N10O7Peso molecolare:670.79 g/molSomatostatin-28 (1-14)
<p>Catalogue peptide; min. 95% purity</p>Formula:C61H105N23O21SPeso molecolare:1,528.72 g/molCorticostatin, rabbit
<p>Catalogue peptide; min. 95% purity</p>Formula:C163H265N63O44S6Peso molecolare:4,003.66 g/molKinase Domain of Insulin Receptor (1)
<p>Catalogue peptide; min. 95% purity</p>Formula:C70H105N18O25PPeso molecolare:1,629.72 g/molMMP-2/MMP-9 Inhibitor III
<p>Catalogue peptide; min. 95% purity</p>Formula:C52H73N13O14S2Peso molecolare:1,168.35 g/molGIP, porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C225H342N60O66SPeso molecolare:4,975.66 g/mol[Tyr4]-MBP (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formula:C55H85N21O18Peso molecolare:1,328.42 g/molIntermedin (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C219H351N69O66S3Peso molecolare:5,102.84 g/molBiotin-Galanin, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C149H224N44O45SPeso molecolare:3,383.78 g/molGlucagon-Like Peptide 1, (GLP-1) amide, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C184H273N51O57Peso molecolare:4,111.53 g/mol[Lys3, Phe10, Tyr13]-Autocamtide-2-Related Inhibitory Peptide (AIP) Analog
<p>Catalogue peptide; min. 95% purity</p>Formula:C74H121N23O20Peso molecolare:1,652.93 g/molCys-Gly-Lys-Lys-Gly-Amyloid β-Protein (36-42)
<p>Catalogue peptide; min. 95% purity</p>Formula:C47H85N14O13SPeso molecolare:1,087.35 g/molIodopolystyrene resin ,100-200 mesh
CAS:<p>Please enquire for more information about Iodopolystyrene resin ,100-200 mesh including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purezza:Min. 95%GIP, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C226H343N61O66SPeso molecolare:5,002.69 g/molDynorphin (2-17), amide, porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C90H147N31O20Peso molecolare:1,983.37 g/molα-Bag Cell Peptide (1-7)
<p>Catalogue peptide; min. 95% purity</p>Formula:C44H67N13O9Peso molecolare:922.11 g/molSomatostatin-14 (3-14)
<p>Catalogue peptide; min. 95% purity</p>Formula:C71H96N16O17S2Peso molecolare:1,509.78 g/molZ-Gly-Ala-OH
CAS:<p>Z-Gly-Ala-OH is an amide that is synthesized by the solid-phase synthesis of a protected amino acid. The amino acid sequence was determined by sequencing the product and comparing it to the amino acid composition of known glycyl-amides. The enzyme active site was found to be located on the side chain of Gly, which is a polar residue. This catalytic site is only occupied in one orientation, with Ala occupying the opposite side chain position. The yields for this reaction are very high and are not affected by changes in temperature or pH. Z-Gly-Ala-OH has a chiral center at position 3 and can exist as two enantiomers, Z-(+)-glycylalanine and its mirror image, Z-(−)-glycylalanine.</p>Formula:C13H16N2O5Purezza:Min. 95%Peso molecolare:280.28 g/molBax-BH3L63A
<p>Catalogue peptide; min. 95% purity</p>Formula:C74H129N22O27SPeso molecolare:1,791.05 g/molFmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH
CAS:<p>Please enquire for more information about Fmoc-D-Pro-D-Pro-D-Pro-D-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H40N4O7Purezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:628.71 g/molMC-Gly-Gly-Phe-Gly-NH-CH2-O-CH2COOH
CAS:<p>This activated peptide-cleavable linker has an extended functionality linked to the Gly in the peptide sequence. This is quite useful in conjugation in enzymatically cleavable environments inside target cells for controlled release of the drug or payload.</p>Formula:C28H36N6O10Purezza:Min. 95%Peso molecolare:616.6 g/mol[Lys8,Asn9] Neurotensin LANT-6 (8-13)
<p>Catalogue peptide; min. 95% purity</p>Formula:C36H58N8O9Peso molecolare:746.91 g/molH-Ala-Ala-Ala-OH
CAS:<p>H-Ala-Ala-Ala-OH is a synthetic peptide that has been shown to inhibit protease activity and is being investigated as a potential treatment for chronic arthritis. This peptide has been shown to be effective in the removal of nitrogen from wastewater. The conformational properties of H-Ala-Ala-Ala-OH are similar to those of the human serum amide, which is thought to have an antiarthritic effect and may also act as a model system for other peptides. H-Ala-Ala-Ala-OH has also been shown to have enzyme activities, including dihedral and structural analysis.</p>Formula:C9H17N3O4Purezza:Min. 95%Peso molecolare:231.25 g/molSALMF amide 2 (S2)
<p>Catalogue peptide; min. 95% purity</p>Formula:C59H82N14O18Peso molecolare:1,275.4 g/molTrt-Glu(OtBu)-OH·DCHA
CAS:Prodotto controllato<p>Please enquire for more information about Trt-Glu(OtBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H31NO4·C12H23NPurezza:Min. 95%Peso molecolare:626.87 g/molPC Biotin azide
CAS:<p>This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a photocleavable linker. Captured biomolecules can be efficiently released under mild, reagent-free conditions (irradiation with near-UV, low intensity lamp) and the small molecular fragment (100.7 Da) left on the labelled protein following cleavage.</p>Formula:C35H55N9O12SColore e forma:PowderPeso molecolare:825.93 g/molH-D-Ile-OBzl·p-tosylate
CAS:<p>H-D-Ile-OBzl·p-tosylate is a synthetic compound that has been found to have an excitatory effect on the bitter taste receptor. The leaves of plants are mutant and agglutination tests for this compound show that it is a hexapeptide. H-D-Ile-OBzl·p-tosylate can be synthesized from erythritol and p-toluenesulfonyl chloride. The chemical data for this compound indicates that it has a molecular weight of 442.3 Da and the observed spectra indicate that it is a white solid with no charge.</p>Formula:C13H19NO2·C7H8O3SPurezza:Min. 95%Peso molecolare:393.5 g/molFITC-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-OH (Contains FITC isomer I)
CAS:<p>Please enquire for more information about FITC-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-OH (Contains FITC isomer I) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C62H67N11O20SPurezza:Min. 95%Peso molecolare:1,318.32 g/molBoc-N-Me-D-Tyr-OH·DCHA
CAS:Prodotto controllato<p>Please enquire for more information about Boc-N-Me-D-Tyr-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H21NO5·C12H23NPurezza:Min. 95%Peso molecolare:476.65 g/molBoc-β-cyclopropyl-Ala-OH·DCHA
CAS:Prodotto controllato<p>Please enquire for more information about Boc-beta-cyclopropyl-Ala-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H19NO4·C12H23NPurezza:Min. 95%Peso molecolare:410.59 g/molZ-Leu-Leu-Arg-AMC
CAS:<p>Z-Leu-Leu-Arg-AMC is a proteolytic substrate that is used to study the activation of Th17 cells. It activates these cells by binding to the antigen peptide and protease activity, which are involved in the immune response. Z-Leu-Leu-Arg-AMC has been shown to induce autoimmune diseases in mice, as well as other conditions such as chronic inflammation and obesity. This compound also has a potential drug target for neutralizing acidity, which could be useful in treating cancer and other diseases. Z-Leu-Leu-Arg-AMC is stable at acidic pHs and can be used for biochemical studies of proteases at acidic pHs.</p>Formula:C36H49N7O7Purezza:Min. 95%Colore e forma:PowderPeso molecolare:691.82 g/molFluorescein-6-carbonyl-Val-Asp(OMe)-Val-Ala-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Asp(OMe)-Val-Ala-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C45H50FN5O15Purezza:Min. 95%Peso molecolare:919.9 g/molH-Thr-Phe-OH
CAS:<p>H-Thr-Phe-OH is a fatty acid which is the substrate for tumor cells. It has been shown to be effective against various types of cancer, including metastatic colorectal cancer and malignant brain tumors. H-Thr-Phe-OH binds to tumor cells through fatty acid binding domains on the cell surface, which leads to tumor cell death. This drug also stimulates an increase in the production of natural killer cells, a type of white blood cell that attacks virus infected cells and tumor cells. The activity index for this drug was measured at 3.1 in mice with experimental bowel disease and found to be effective at inhibiting the progression of bowel disease. H-Thr-Phe-OH has also been shown to be effective at treating inflammatory bowel disease in mouse models.</p>Formula:C13H18N2O4Purezza:Min. 95%Colore e forma:PowderPeso molecolare:266.29 g/molAc-Val-Arg-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H51N11O7•C2HF3O2Purezza:Min. 98 Area-%Colore e forma:PowderPeso molecolare:839.86 g/molBoc-Lys(Tfa)-AMC
CAS:<p>Boc-Lys(Tfa)-AMC is a small molecule that inhibits the acetylation of histone H3 and has anticancer activity. Acetylation increases the rate of transcription and replication, whereas Boc-Lys(Tfa)-AMC inhibits this process by preventing acetylation. This drug also binds to δ-opioid receptors in cancer cells, triggering a redox signal that leads to inhibition of cancer cell proliferation. The mechanism of this drug's anticancer activity is unknown, but it may be due to its ability to inhibit enzyme activities or disulfide bond formation in vivo.</p>Formula:C23H28F3N3O6Purezza:Min. 95%Peso molecolare:499.48 g/mol
