Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30476 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Fibrinogen β-Chain (24-42)
<p>Catalogue peptide; min. 95% purity</p>Formula:C86H135N25O27Peso molecolare:1,951.19 g/molDynorphin A (7-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C65H108N22O16Peso molecolare:1,453.72 g/molbFGF Inhibitory Peptide II
<p>Catalogue peptide; min. 95% purity</p>Formula:C94H148N30O28SPeso molecolare:2,178.48 g/molα-CGRP (33-37) (canine, mouse, porcine, rat)
<p>Catalogue peptide; min. 95% purity</p>Formula:C22H32N6O8Peso molecolare:508.54 g/mol[D-Glu5,D-Trp7,9,10]-Substance P (5-11)
<p>Catalogue peptide; min. 95% purity</p>Formula:C57H66N12O10SPeso molecolare:1,111.30 g/molβ-Amyloid (8-38)
<p>Catalogue peptide; min. 95% purity</p>Formula:C147H227N39O43SPeso molecolare:3,260.75 g/molScyliorhinin I, Scy I
<p>Catalogue peptide; min. 95% purity</p>Formula:C59H86N12O14SPeso molecolare:1,219.48 g/molPhosphorylated Protein Kinase C Substrate 1
<p>Catalogue peptide; min. 95% purity</p>Formula:C57H96N23O18PPeso molecolare:1,422.54 g/molabIII probe
<p>Catalogue peptide; min. 95% purity</p>Formula:C87H115N23O24SPeso molecolare:1,899.09 g/molAngiotensin II Receptor, AT2, Amino Terminal Fragment
<p>Catalogue peptide; min. 95% purity</p>Formula:C79H125N23O28SPeso molecolare:1,877.08 g/molAlternate Syntide
<p>Catalogue peptide; min. 95% purity</p>Formula:C63H112N18O19Peso molecolare:1,425.70 g/molCeratotoxin B
<p>Catalogue peptide; min. 95% purity</p>Formula:C135H235N35O32Peso molecolare:2,860.59 g/mol[Phe1376]-Fibronectin Fragment (1371-1382)
<p>Catalogue peptide; min. 95% purity</p>Formula:C63H103N25O19Peso molecolare:1,514.68 g/molSaposin C18
<p>Catalogue peptide; min. 95% purity</p>Formula:C93H164N24O31Peso molecolare:2,114.49 g/molGAD65 (78-97)
<p>Catalogue peptide; min. 95% purity</p>Formula:C97H148N26O29S2Peso molecolare:2,206.53 g/molGLP-2 (rat)
<p>Catalogue peptide; min. 95% purity</p>Formula:C166H256N44O56SPeso molecolare:3,796.22 g/molα-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)
<p>Catalogue peptide; min. 95% purity</p>Formula:C18H33N5O4Peso molecolare:383.49 g/molβ-Endorphin (6-31), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C131H218N34O40Peso molecolare:2,909.40 g/molAcyl Carrier Protein (65-74) (amide)
<p>Catalogue peptide; min. 95% purity</p>Formula:C47H75N13O15Peso molecolare:1,062.20 g/molTNF-α (72-82), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C48H86N18O16Peso molecolare:1,171.33 g/molProinsulin C-peptide (55-89), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C153H259N49O52Peso molecolare:3,616.98 g/molBiotin-LC-Neurogranin (28-43)
<p>Catalogue peptide; min. 95% purity</p>Formula:C94H159N31O20S2Peso molecolare:2,139.48 g/mol[Lys4] Sarafotoxin S6c
<p>Catalogue peptide; min. 95% purity</p>Formula:C105H153N27O36S5Peso molecolare:2,529.87 g/molAllatostatin VI
<p>Catalogue peptide; min. 95% purity</p>Formula:C65H90N18O16Peso molecolare:1,379.5 g/molBiotin-RR-SRC, Insulin Receptor Tyrosine Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Peso molecolare:1,745.99 g/molTNF-α (31-45), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C69H122N26O22Peso molecolare:1,667.90 g/molPACAP(1-38)-Lys(Biotin), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C219H357N67O56S2Peso molecolare:4,888.83 g/molZ-Ile-Trp-OH
CAS:<p>Please enquire for more information about Z-Ile-Trp-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H29N3O5Purezza:Min. 95%Peso molecolare:451.51 g/molCDC25C
<p>Catalogue peptide; min. 95% purity</p>Formula:C115H198N40O33SPeso molecolare:2,701.17 g/molH-Thr-Asp-OH TFA salt
CAS:<p>Please enquire for more information about H-Thr-Asp-OH TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H14N2O6C2F3HO2Purezza:Min. 95%Peso molecolare:348.23 g/molβ-Amyloid (12-28)
<p>Catalogue peptide; min. 95% purity</p>Formula:C89H135N25O25Peso molecolare:1,955.22 g/molβ-Interleukin II (44-56)
<p>Catalogue peptide; min. 95% purity</p>Formula:C68H113N19O19Peso molecolare:1,500.77 g/mol[Tyr6,D-Phe7,D-His9]-Substance P (6-11)
<p>Catalogue peptide; min. 95% purity</p>Formula:C44H57N9O7SPeso molecolare:856.07 g/mol[Ile76]-TNF-a (70-80) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C55H91N15O16Peso molecolare:1,218.43 g/molBig Endothelin-1 (1-39), porcine
<p>Please enquire for more information about Big Endothelin-1 (1-39), porcine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Biotin-Bradykinin
<p>Catalogue peptide; min. 95% purity</p>Formula:C60H87N17O13SPeso molecolare:1,286.53 g/molGalanin (1-13)-Spantide I
<p>Catalogue peptide; min. 95% purity</p>Formula:C138H199N35O30Peso molecolare:2,828.34 g/mol(D-His2,D-Ser(tBu)6,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-His2,D-Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O14Purezza:Min. 95%Peso molecolare:1,269.41 g/molH-D-Val-Leu-Lys-pNA·2 HCl
CAS:<p>D-Val-Leu-Lys-p-nitroanilide is a selective colorimetric substrate for plasmin used to determine plasmin formation from plasminogen in amidolytic activity assays and plasminogen activating assays. Plasmin is a plasma serine protease whose main role is to dissolve fibrin blood clots. After cleavage by plasmin, the protease activity is quantified by the release of p-nitroaniline (pNA) from the substrate.</p>Formula:C23H38N6O5·2HClPurezza:Min. 95%Peso molecolare:551.51 g/molLeucokinin IV
<p>Catalogue peptide; min. 95% purity</p>Formula:C41H52N12O12Peso molecolare:904.9 g/molBiotin-Parathyroid Hormone (1-34), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C191H305N57O53S3Peso molecolare:4,344 g/molgp100 (619-627)
<p>Catalogue peptide; min. 95% purity</p>Formula:C49H82N14O14SPeso molecolare:1,123.35 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS:<p>Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H36N2O9Purezza:Min. 95%Peso molecolare:604.65 g/molBTK derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C72H115N17O18S2Peso molecolare:1,570.95 g/molCaspase 1 Substrate 1 (ICE), chromogenic
<p>Catalogue peptide; min. 95% purity</p>Formula:C217H322N58O60SPeso molecolare:4,767.47 g/mol[D-Ala2]-β-Casomorphin (1-5), bovine
<p>Catalogue peptide; min. 95% purity</p>Formula:C28H35N5O7Peso molecolare:553.6 g/molOV-2, Sheep
<p>Catalogue peptide; min. 95% purity</p>Formula:C84H159N29O14Peso molecolare:1,799.39 g/molSaposin C22
<p>Catalogue peptide; min. 95% purity</p>Formula:C116H196N28O37SPeso molecolare:2,607.02 g/molFibronectin Analog
<p>Catalogue peptide; min. 95% purity</p>Formula:C29H51N11O11Peso molecolare:729.80 g/molα-Gliadin (57-73)
<p>Catalogue peptide; min. 95% purity</p>Formula:C93H136N22O27Peso molecolare:1,994.25 g/molBiotin-Pancreatic Polypeptide, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C195H301N55O56S3Peso molecolare:4,407.99 g/mol[D-Ala2,Met5]-β-Casomorphin (1-5 , bovine ,amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C31H42N6O6SPeso molecolare:626.78 g/mol[Asn670,Leu671]-Amyloid β/A4 Protein Precursor770 (667-676)
<p>Catalogue peptide; min. 95% purity</p>Formula:C50H78N14O19Peso molecolare:1,179.26 g/molCorticotropin Releasing Factor, human, rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C208H344N60O63S2Peso molecolare:4,757.44 g/molCathepsin G (77-83)
<p>Catalogue peptide; min. 95% purity</p>Formula:C40H59N15O12Peso molecolare:942.01 g/molcAMP Dependent PK Inhibitor (5-22), amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C84H137N29O26Peso molecolare:1,969.16 g/mol[Met2]-Deltorphin
<p>Catalogue peptide; min. 95% purity</p>Formula:C44H62N10O10S2Peso molecolare:955.17 g/molMSP-1 (20-39), Merozoite Surface Peptide 1
<p>Catalogue peptide; min. 95% purity</p>Formula:C102H165N25O35Peso molecolare:2,301.60 g/molPreproenkephalin B (186-204), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C78H115N21O36SPeso molecolare:1,954.97 g/molIsovaleryl-Phe-Lys-pNA·HCl
CAS:<p>Please enquire for more information about Isovaleryl-Phe-Lys-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H35N5O5·HClPurezza:Min. 95%Peso molecolare:534.05 g/molHSV-gB2 (498-505) acetate
CAS:<p>Custom research peptide; min purity 95%.</p>Formula:C41H67N11O13•(C2H4O2)xPurezza:Min. 95%Peso molecolare:922.06 g/molCalcitonin, eel
<p>Catalogue peptide; min. 95% purity</p>Formula:C146H241N43O47S2Peso molecolare:3,414.94 g/mol[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]
<p>Catalogue peptide; min. 95% purity</p>Formula:C67H110N20O17Peso molecolare:1,467.75 g/molGastrin-1, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C97H125N20O31SPeso molecolare:2,098.22 g/molproFIX28
<p>Catalogue peptide; min. 95% purity</p>Formula:C149H235N43O44Peso molecolare:3,332.80 g/mol[Trp7,β-Ala8]-Neurokinin A (4-10)
<p>Catalogue peptide; min. 95% purity</p>Formula:C41H57N9O10SPeso molecolare:868.03 g/molβ-Amyloid (1-33)
<p>Catalogue peptide; min. 95% purity</p>Formula:C164H242N46O51Peso molecolare:3,673.94 g/molBradykinin-Like Neuropeptide (3-11) (Aplysia californica)
<p>Catalogue peptide; min. 95% purity</p>Formula:C42H77N21O12Peso molecolare:1,068.22 g/molLytic Peptide, Shiva - 1
<p>Catalogue peptide; min. 95% purity</p>Formula:C155H269N53O39SPeso molecolare:3,531.27 g/molSALMF amide 2 (S2)
<p>Catalogue peptide; min. 95% purity</p>Formula:C59H82N14O18Peso molecolare:1,275.4 g/molGRF, porcine
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C219H365N73O66SPeso molecolare:5,108.86 g/mol[Asn670,Leu671]-Amyloid β/A4 Protein Precursor770 (667-675)
<p>Catalogue peptide; min. 95% purity</p>Formula:C44H66N10O18Peso molecolare:1,023.07 g/mol[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)
<p>Catalogue peptide; min. 95% purity</p>Formula:C58H77N13O10Peso molecolare:1,116.34 g/molLHRH, salmon
<p>Catalogue peptide; min. 95% purity</p>Formula:C60H73N15O13Peso molecolare:1,212.36 g/molch-Relaxing Peptide (CARP)
<p>Catalogue peptide; min. 95% purity</p>Formula:C36H67N11O7S2Peso molecolare:830.13 g/mol(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C57H72N14O8Purezza:Min. 95%Peso molecolare:1,081.27 g/molBone Matrix Proteins
<p>Catalogue peptide; min. 95% purity</p>Formula:C40H67N13O14Peso molecolare:954.06 g/molN-Acetyl-L-norleucyl-L-a-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-lysinamide-(2,7) -lactam
CAS:<p>Please enquire for more information about N-Acetyl-L-norleucyl-L-a-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-L-lysinamide-(2,7) -lactam including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H71N15O9Purezza:Min. 95%Peso molecolare:1,074.24 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C62H97N21O16S1Peso molecolare:1,424.66 g/molL-Lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysine
CAS:<p>L-Lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysine (LLLLLL) is an antibacterial agent that belongs to the class of pharmacological agents. LLLLLL has been shown to have antibacterial efficacy against oral pathogens, such as Streptococcus mutans and Porphyromonas gingivalis. LLLLLL binds to the bacterial cell wall by forming a covalent disulfide bond with cysteine residues on the peptidoglycan layer. This prevents cell wall synthesis, leading to cell death by inhibiting protein synthesis. LLLLLL has also been shown to have low toxicity in animal models for long periods of time, with high values in human serum.</p>Formula:C30H62N10O6Purezza:Min. 95%Peso molecolare:658.88 g/molCC Chemokine Receptor 3 Fragment I, amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C142H223N35O53S2Peso molecolare:3,332.68 g/molInfluenza HA (210-219)
<p>Catalogue peptide; min. 95% purity</p>Formula:C45H74N10O17Peso molecolare:1,027.15 g/molDynorphin A (1-11), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C63H103N21O13Peso molecolare:1,362.66 g/mol[D-Trp2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C36H43N7O6SPeso molecolare:701.85 g/molγ-MSH (3-8)
<p>Catalogue peptide; min. 95% purity</p>Formula:C39H52N12O7SPeso molecolare:832.98 g/molHuman ACTH(18-39) trifluoroacetate
CAS:<p>Please enquire for more information about Human ACTH(18-39) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C112H165N27O36•(C2HF3O2)xβ-Interleukin I (163-171), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C39H64N12O19Peso molecolare:1,005.01 g/molZ-Asu (OtBu)-OH·DCHA
CAS:Prodotto controllato<p>Please enquire for more information about Z-Asu (OtBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C20H29NO6·C12H23NPurezza:Min. 95%Peso molecolare:560.77 g/molPACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat)
<p>Catalogue peptide; min. 95% purity</p>Formula:C61H110N24O14Peso molecolare:1,403.71 g/molα-Conotoxin SIA
<p>Catalogue peptide; min. 95% purity</p>Formula:C60H82N18O17S4Peso molecolare:1,455.7 g/molCathepsin S substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C41H66N12O9Peso molecolare:871.08 g/mol[Pyr4]-MBP (4-14)
<p>Catalogue peptide; min. 95% purity</p>Formula:C60H100N20O17Peso molecolare:1,391.61 g/mol[Val35] -β-Amyloid (1-42)
<p>Catalogue peptide; min. 95% purity</p>Formula:C203H311N55O60Peso molecolare:4,481.96 g/mol[D-Ala2] Deltorphin II
<p>Catalogue peptide; min. 95% purity</p>Formula:C38H54N8O10Peso molecolare:782.90 g/molDecorsin, Leech
<p>Catalogue peptide; min. 95% purity</p>Formula:C179H277N55O62S6Peso molecolare:4,383.87 g/molp3K, (Lys 58 Lys 60 Lys 63) Ea(52-68)
<p>Catalogue peptide; min. 95% purity</p>Formula:C77H129N23O25Peso molecolare:1,777.03 g/molBiotin-Kinase Domain of Insulin Receptor (5)
<p>Catalogue peptide; min. 95% purity</p>Formula:C82H124N21O35SPeso molecolare:1,996.04 g/mol[Met5, Lys6] a-Neo-Endorphin (1-6)
<p>Catalogue peptide; min. 95% purity</p>Formula:C33H47N7O8SPeso molecolare:701.85 g/molα-Neo-Endorphin (1-7)
<p>Catalogue peptide; min. 95% purity</p>Formula:C40H61N11O9Peso molecolare:840.00 g/molMMP-2/MMP-9 Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formula:C44H61N13O13SPeso molecolare:1,012.1 g/mol[Tyr22]-a-CGRP (22-37), rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C82H120N20O25Peso molecolare:1,785.99 g/molAngiotensin I/II (1-6)
CAS:<p>Angiotensin I/II 1-6 is a peptide containing amino acids 1-6; derived from from Angiotensin I/II.</p>Formula:C36H55N11O10Purezza:Min. 95%Peso molecolare:801.89 g/molFibronectin Type III Connecting Segment (1-25)
<p>Catalogue peptide; min. 95% purity</p>Formula:C123H195N31O39Peso molecolare:2,732.04 g/molLL-37, Antimicrobial Peptide, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C205H340N60O53Peso molecolare:4,493.37 g/molFmoc-Mating Factor a TFA salt
CAS:<p>Please enquire for more information about Fmoc-Mating Factor a TFA salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C97H124N20O19S(freebase)Purezza:Min. 95%Peso molecolare:1,906.21 g/molKinase Domain of Pyruvate Kinase, porcine liver
<p>Catalogue peptide; min. 95% purity</p>Formula:C32H62N12O13PPeso molecolare:853.88 g/molUremic Pentapeptide (U5-Peptide)
<p>Catalogue peptide; min. 95% purity</p>Formula:C32H48N8O9Peso molecolare:688.8 g/molKGF Receptor Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C114H174N30O42SPeso molecolare:2,668.90 g/molβ-Defensin-3, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C216H371N75O59S6Peso molecolare:5,155.22 g/molLMP1,TDD
<p>Catalogue peptide; min. 95% purity</p>Formula:C68H102N26O35Peso molecolare:1,843.72 g/mol[Ac-Cys4,DPhe7,Cys10] a-MSH (4-13), amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C61H88N18O13S2Peso molecolare:1,345.61 g/molβ-Amyloid (1-28)
<p>Catalogue peptide; min. 95% purity</p>Formula:C145H209N41O46Peso molecolare:3,262.53 g/molBig Endothelin-1 (22-39), rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C83H135N25O27Peso molecolare:5,511 g/molLamprey PQRFamide
<p>Catalogue peptide; min. 95% purity</p>Formula:C102H147N29O22S2Peso molecolare:2,195.62 g/molBiotin-Dynorphin A (1-17)
<p>Catalogue peptide; min. 95% purity</p>Formula:C109H169N33O25SPeso molecolare:2,373.83 g/mol[D-Phe7] a-MSH, amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C77H109N21O19SPeso molecolare:1,664.92 g/mol[D-Leu2]-Melanocyte-Stimulating Hormone-Release Inhibiting Factor
<p>Catalogue peptide; min. 95% purity</p>Formula:C13H24N4O3Peso molecolare:284.36 g/molBiotin-Angiotensin I, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C72H103N19O16SPeso molecolare:1,522.81 g/molAmyloid β-Protein (25-35) amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C45H82N14O13SPeso molecolare:1,059.31 g/molα-Conotoxin MI
<p>Catalogue peptide; min. 95% purity</p>Formula:C58H92N22O17S4Peso molecolare:1,497.74 g/molβ-Endorphin (1-26), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C130H208N32O38SPeso molecolare:2,859.36 g/molRSK Substrate, S6 (231-239)
<p>Catalogue peptide; min. 95% purity</p>Formula:C45H88N22O11Peso molecolare:1,113.34 g/mol[D-Ala2]-β-Casomorphin (1-4) amide (bovine)
<p>Catalogue peptide; min. 95% purity</p>Formula:C26H33N5O5Peso molecolare:495.58 g/molγ-Bag Cell Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C31H51N11O8Peso molecolare:705.82 g/molSRC Kinase Substrate, amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C64H108N23O23PPeso molecolare:1,598.71 g/molCDPKS, Syntide analog
<p>Catalogue peptide; min. 95% purity</p>Formula:C47H86N16O13Peso molecolare:1,083.31 g/molHypercalcemia Malignancy Factor (1-40)
<p>Catalogue peptide; min. 95% purity</p>Formula:C180H287N57O48Peso molecolare:4,017.55 g/mol[D-His26]-Neuropeptide Y, human, rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C189H285N55O57S1Peso molecolare:4,271.67 g/molBiotin-Angiotensin I/II (1-7)
<p>Catalogue peptide; min. 95% purity</p>Formula:C51H76N14O13SPeso molecolare:1,125.33 g/molN-10 Region of TRAP
<p>Catalogue peptide; min. 95% purity</p>Formula:C51H78N11O21SPeso molecolare:1,213.32 g/molDynorphin A (3-8), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C35H60N12O7Peso molecolare:760.94 g/molDynorphin A (2-12), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C60H105N21O12Peso molecolare:1,312.64 g/mol(1-Adamantaneacetyl1,D-Tyr(Et)2,Val4, Abu 6, Arg8·9)-vasopressin
CAS:<p>(1-Adamantaneacetyl1,D-Tyr(Et)2,Val4, Abu 6, Arg8·9)-vasopressin is a vasopressor analog that has been shown to be an effective treatment for congestive heart failure by acting as an agonist at the V1 receptor. It has been shown to stimulate cyclase activity and increase levels of adenosine 3',5'-cyclic monophosphate (cAMP). This drug also stimulates the production of immunoglobulin A antibodies in mice and increases the expression of leucine aminopeptidase and immunofluorescence in rat kidney cells. Vasopressin analogs are used primarily for their vasoconstrictive properties.</p>Formula:C62H94N16O11Purezza:Min. 95%Colore e forma:White Off-White PowderPeso molecolare:1,239.51 g/molBiotin-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Formula:C86H118N20O21S3Peso molecolare:1,864.21 g/molDynorphin A (8-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C59H96N18O15Peso molecolare:1,297.53 g/mol[D-Ala2] Met-Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Formula:C28H37N5O7SPeso molecolare:587.70 g/molADP-Ribosylation Factor 6, ARF6 (2-13)
<p>Catalogue peptide; min. 95% purity</p>Formula:C60H102N16O17Peso molecolare:1,319.58 g/molGSK3 Peptide Substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C470H76N16O16Peso molecolare:1,121.23 g/molCys-Gly-Lys-Lys-Gly-Amyloid β-Protein (37-42)
<p>Catalogue peptide; min. 95% purity</p>Formula:C42H77N13O12SPeso molecolare:988.22 g/molCJC-1295 trifluoroacetate
CAS:<p>A synthetic peptide that stimulates growth hormone release through GHRH receptors. TFA salt</p>Formula:C165H269N47O46Purezza:Min. 95%Colore e forma:PowderPeso molecolare:3,647.19 g/molβ-Amyloid (10-20)
<p>Catalogue peptide; min. 95% purity</p>Formula:C71H99N17O16Peso molecolare:1,446.68 g/molβ-Amyloid Protein Precursor 770 (135-155)
<p>Catalogue peptide; min. 95% purity</p>Formula:C116H173N35O31S2Peso molecolare:2,617.95 g/molGlucagon-Like Peptide 1 (7-17)-Cys, GLP-1 (7-17)-Cys
<p>Catalogue peptide; min. 95% purity</p>Formula:C192H295N59O60SPeso molecolare:4,421.92 g/mol[D-Ala2,DPro4,Tyr5]-β-Casomorphin (1-5), amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C35H42N6O7Peso molecolare:658.8 g/molIntermedin-53 (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C247H397N83O73S3Peso molecolare:5,793.61 g/molADR1-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C65H114N22O18Peso molecolare:1,491.77 g/molR-G-D-S-P-A-S-S-K-P
<p>Catalogue peptide; min. 95% purity</p>Formula:C40H68N14O16Peso molecolare:1,001.07 g/molAmyloid Bri Protein (1-34)
<p>Catalogue peptide; min. 95% purity</p>Formula:C173H273N49O52S2Peso molecolare:3,935.55 g/molAtrial Natriuretic Factor (4-28) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C112H175N39O35S3Peso molecolare:2,724.02 g/molSelectin
<p>Catalogue peptide; min. 95% purity</p>Formula:C62H105N16O18S2Peso molecolare:1,426.75 g/molCecropin A (1-7)-Melittin A (2-9) amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C89H152N22O15Peso molecolare:1,770.34 g/molβ-Amyloid (1-34)
<p>Catalogue peptide; min. 95% purity</p>Formula:C170H253N47O52Peso molecolare:3,787.20 g/molProlactin Releasing Peptide (12-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Formula:C103H156N32O25Peso molecolare:2,242.59 g/molMca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C49H68N14O15Purezza:Min. 95%Peso molecolare:1,093.15 g/molBoc-Val-Leu-Lys-AMC acetate salt
CAS:<p>Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.</p>Formula:C32H49N5O7•C2H4O2Purezza:Min. 98 Area-%Colore e forma:PowderPeso molecolare:675.81 g/molAdipokinetic Hormone (Apis mellifera ligustica) TFA salt
CAS:<p>Adipokinetic hormone is a peptide hormone that has been shown to stimulate the metabolism of fat cells in laboratory animals. This peptide is produced by the gland cells of honeybees and is used to regulate the energy metabolism of honeybees and other insects. Adipokinetic hormone has been shown to increase locomotor activity, inhibit the growth of human pathogens, activate transfer reactions, and inhibit receptor activity. The biological properties of this hormone have not yet been fully elucidated.</p>Formula:C47H65N11O14•C2HF3O2Purezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:1,122.10 g/mol4A/4B, Peptide (1)
<p>Catalogue peptide; min. 95% purity</p>Formula:C67H100N16O25S2Peso molecolare:1,593.76 g/molInfluenza PR8 Hemagglutinin Peptide (110-119) trifluoroacetate salt
CAS:<p>Influenza PR8 Hemagglutinin Peptide (110-119) trifluoroacetate salt H-Ser-Phe-Glu-Arg-Phe-Glu-Ile-Phe-Pro-Lys-OH trifluoroacetate sa lt is a surface glycoprotein that has been shown to enhance the survival of neuronal cells. It is also involved in the regulation of energy metabolism and iron homeostasis, as well as in the induction of autoimmune diseases. This peptide contains a hydroxyl group, which can be oxidized by reactive oxygen species and may have neurotrophic effects. Trifluoroacetate salts of this protein are ester linkages that bind iron tightly and have been used for the treatment of iron overload.</p>Formula:C63H90N14O16Purezza:Min. 95%Peso molecolare:1,299.47 g/molInsulin B (22-25)
CAS:<p>Please enquire for more information about Insulin B (22-25) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C26H35N7O5Purezza:Min. 95%Peso molecolare:525.6 g/molFluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H43FN4O14Purezza:Min. 95%Peso molecolare:834.8 g/molFluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H49FN4O14Purezza:Min. 95%Peso molecolare:876.88 g/molKinase Domain of Insulin Receptor (3)
<p>Catalogue peptide; min. 95% purity</p>Formula:C72H108N19O27Peso molecolare:1,702.77 g/molSubstance P reversed sequence
<p>Catalogue peptide; min. 95% purity</p>Formula:C63H98N18O13SPeso molecolare:1,347.66 g/molTachykinin (111-129) β-Prepro (Human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C96H156N34O31SPeso molecolare:2,314.59 g/molGPC3 (298-306), mouse
<p>Catalogue peptide; min. 95% purity</p>Formula:C51H81N9O18Peso molecolare:1,108.26 g/mol[Phe7] Dynorphin A (1-7), amide, porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C43H59N11O8Peso molecolare:858.02 g/molLL-37 pentamide
<p>Catalogue peptide; min. 95% purity</p>Formula:C208H343N65O48Peso molecolare:4,522.46 g/molpp60 C-SRC Carboxy-Terminal Phosphoregulatory Peptide Phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Formula:C62H95N16O28PPeso molecolare:1,543.53 g/molSuccinyl-(Glu9,Ala11·15)-Endothelin-1 (8-21)
CAS:<p>Sovateltide is a peptide that is composed of 21 amino acids. It is an agonist of the endothelin receptors ET A and ET B. Succinyl-(Glu9,Ala11·15)-Endothelin (8,21) Sovateltide has been shown to be neuroprotective in preclinical studies and may have potential as a therapeutic agent for the treatment of radiation damage to the brain.</p>Formula:C86H117N17O27Purezza:Min. 95%Peso molecolare:1,820.95 g/molCys-Gly-His-Gly-Asn-Lys-Ser-Amyloid β-Protein (33-40)
<p>Catalogue peptide; min. 95% purity</p>Formula:C58H99N19O18S2Peso molecolare:1,414.67 g/molAntho-Rwamide II
<p>Catalogue peptide; min. 95% purity</p>Formula:C30H44N10O6Peso molecolare:640.79 g/molEpidermal Mitosis Inhibiting Pentapeptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C19H27N5O12Peso molecolare:517.45 g/mol(2-Methylindol-1-yl)acetic acid·DCHA
CAS:Prodotto controllato<p>Please enquire for more information about (2-Methylindol-1-yl)acetic acid·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H11NO2·C12H23NPurezza:Min. 95%Peso molecolare:370.53 g/molTryptophan Motif Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C35H41N11O7Peso molecolare:727.79 g/molLeptin (22-56), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C171H298N50O56Peso molecolare:3,950.49 g/molAmyloid b-Protein (1-42) (mouse, rat)
CAS:<p>Please enquire for more information about Amyloid b-Protein (1-42) (mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C199H307N53O59SPurezza:Min. 95%Peso molecolare:4,417.95 g/mol[Pyr5]-Substance P (5-11)
<p>Catalogue peptide; min. 95% purity</p>Formula:C41H57N9O9SPeso molecolare:852.05 g/molBoc-Leu-Gly-Arg-pNA
CAS:<p>a chromogenic substrate for horseshoe crab clotting enzyme, which is used in quantitative assays of endotoxin.</p>Formula:C25H40N8O7Colore e forma:PowderPeso molecolare:564.63 g/mol[D-Phe11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Formula:C78H121N21O19Peso molecolare:1,657 g/molFITC-Tyr-Val-Ala-Asp-OH (Contains FITC isomer I)
CAS:<p>FITC-Tyr-Val-Ala-Asp-OH (Contains FITC isomer I) is a bioactive molecule that has been shown to inhibit the growth of filamentous fungi. This compound binds to the tyrosine kinase, which is an enzyme involved in the regulation of cell division and differentiation. It also inhibits neutrophil recruitment by dectin-1, a protein that recognizes fungal cell walls on neutrophils. The FITC isomer I has been shown to impair macrophages and fungus aspergillus fumigatus infiltration in tissues with impaired immune function.<br>FITC-Tyr-Val-Ala-Asp-OH (Contains FITC isomer I) has also been shown to decrease the production of caspase 1, which activates inflammatory responses and stimulates phagocytic cells.</p>Formula:C42H39N5O12SPurezza:Min. 95%Peso molecolare:837.85 g/molAc-Arg-Ser-Leu-Lys-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Arg-Ser-Leu-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H51N9O8•C2HF3O2Purezza:Min. 95 Area-%Colore e forma:PowderPeso molecolare:815.83 g/molN-α-Benzoyl-L-argininamide
CAS:<p>N-alpha-Benzoyl-L-argininamide is a synthetic compound that is used as an enzyme inhibitor. It binds to the active site of proteases, thereby inhibiting their activity. This drug has been shown to inhibit the activities of phosphodiesterase and phosphatase enzymes in vitro. N-alpha-Benzoyl-L-argininamide also inhibits the proteolytic degradation of hippuric acid and casein in vitro. The binding affinity for this drug is due to its structural similarity with substrates such as glutamate and rhizosphere exudates.</p>Formula:C13H19N5O2Purezza:Min 98%Colore e forma:White PowderPeso molecolare:277.32 g/mol(Hyp 3,b-(2-thienyl)-Ala5,Tyr(Me)8-psi(CH2NH)Arg9)-Bradykinin trifluoroacetate salt
CAS:<p>Bradykinin is a peptide hormone that is produced in the body and has various physiological effects, such as vasodilation, bronchoconstriction, and the release of histamine from mast cells. Bradykinin is also used in pharmacological treatments for malignant brain tumors, congestive heart failure, and epidermal growth factor-responsive dermatoses. Bradykinin can be administered intravenously or subcutaneously to treat these conditions. The drug can also be administered intraperitoneally to treat high blood pressure during pregnancy. Bradykinin is an ester of 3-b-(2-thienyl)-Ala5,Tyr(Me)8-psi(CH2NH)Arg9-OH with trifluoroacetic acid. It is synthesized by linking two molecules together through an ester bond. This drug has many beneficial effects on the human body due to its ability to inhibit enzymes that are involved in the production of prostagland</p>Formula:C49H75N15O12SPurezza:Min. 95%Colore e forma:PowderPeso molecolare:1,098.28 g/molδ-Sleep Inducing Peptide trifluoroacetate salt
CAS:<p>Delta-Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu-OH trifluoroacetate salt is a peptide that has been shown to have a hypnotic effect in mice. It was found to increase the time spent on the rotarod and decrease locomotor activity in mice. This drug has also been shown to be hypoglycemic and to modulate transcriptional regulation of fatty acid metabolism. Delta Sleep Inducing Peptide trifluoroacetate salt H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly Gly Glu OH trifluoroacetate salt may be useful in treating autoimmune diseases, such as multiple sclerosis, due to its ability to regulate 5HT concentrations.</p>Formula:C35H48N10O15Peso molecolare:848.81 g/molH-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH
CAS:<p>H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH is a proteolytic inhibitor that inhibits the aspartic and hydrolytic enzymes. It has been shown to inhibit the activity of trypsin, pepsin, and elastase in human serum. This inhibitor also inactivates fibronectin by proteolysis. H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu OH has been shown to be specific for acidic proteases such as pepsin. The natural inhibitors of this peptide are Pro, Thr, Glu, Phe, Arg and Leu.</p>Formula:C44H63N11O13Purezza:Min. 95%Colore e forma:PowderPeso molecolare:954.04 g/molH-GTSLSPPPESSGSPQQPGLSAPHSRQIPAPQGA VLVQREKDLPNYNWNSFGLRF-NH2
<p>Kisspeptin P</p>Formula:C257H393N75O78Purezza:Min. 95%Prolactin Releasing Peptide (12-31), rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C104H158N32O26Peso molecolare:2,272.62 g/molAmyloid β-Protein (20-29)
<p>Catalogue peptide; min. 95% purity</p>Formula:C43H66N12O17Peso molecolare:1,023.08 g/mol
![[D-Glu5,D-Trp7,9,10]-Substance P (5-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00139.webp&w=3840&q=75)
![[Phe1376]-Fibronectin Fragment (1371-1382)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00679.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00035.webp&w=3840&q=75)
![[Lys4] Sarafotoxin S6c](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00293.webp&w=3840&q=75)
![[Tyr6,D-Phe7,D-His9]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00840.webp&w=3840&q=75)
![[Ile76]-TNF-a (70-80) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00637.webp&w=3840&q=75)
![[D-Ala2]-β-Casomorphin (1-5), bovine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00829.webp&w=3840&q=75)
![[D-Ala2,Met5]-β-Casomorphin (1-5 , bovine ,amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00831.webp&w=3840&q=75)
![[Asn670,Leu671]-Amyloid β/A4 Protein Precursor770 (667-676)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00714.webp&w=3840&q=75)
![[Met2]-Deltorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00898.webp&w=3840&q=75)
![[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00495.webp&w=3840&q=75)
![[Trp7,β-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00349.webp&w=3840&q=75)
![[Asn670,Leu671]-Amyloid β/A4 Protein Precursor770 (667-675)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00713.webp&w=3840&q=75)
![[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00148.webp&w=3840&q=75)
![[D-Trp2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00844.webp&w=3840&q=75)
![[Pyr4]-MBP (4-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00186.webp&w=3840&q=75)
![[Val35] -β-Amyloid (1-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00311.webp&w=3840&q=75)
![[D-Ala2] Deltorphin II](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00826.webp&w=3840&q=75)
![[Met5, Lys6] a-Neo-Endorphin (1-6)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00875.webp&w=3840&q=75)
![[Tyr22]-a-CGRP (22-37), rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00924.webp&w=3840&q=75)
![[Ac-Cys4,DPhe7,Cys10] a-MSH (4-13), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00024.webp&w=3840&q=75)
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
![[D-Leu2]-Melanocyte-Stimulating Hormone-Release Inhibiting Factor](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00620.webp&w=3840&q=75)
![[D-Ala2]-β-Casomorphin (1-4) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00833.webp&w=3840&q=75)
![[D-His26]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00910.webp&w=3840&q=75)
![[D-Ala2] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00839.webp&w=3840&q=75)
![[D-Ala2,DPro4,Tyr5]-β-Casomorphin (1-5), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00823.webp&w=3840&q=75)
![[Phe7] Dynorphin A (1-7), amide, porcine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00865.webp&w=3840&q=75)
![Atrial Natriuretic Peptide Substrate, [pS6] ANF 1-28](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00729.webp&w=3840&q=75)
![[Pyr5]-Substance P (5-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00195.webp&w=3840&q=75)
![[D-Phe11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00191.webp&w=3840&q=75)
