Peptidi
I peptidi sono catene corte di amminoacidi legate da legami peptidici, che svolgono ruoli chiave come molecole biologiche importanti nei processi cellulari. Funzionano come ormoni, neurotrasmettitori e molecole di segnalazione, e sono ampiamente utilizzati in applicazioni terapeutiche e diagnostiche. I peptidi sono anche cruciali nella ricerca per lo studio delle interazioni proteiche, delle attività enzimatiche e dei percorsi di segnalazione cellulare. Presso CymitQuimica, offriamo una vasta selezione di peptidi di alta qualità per supportare le vostre esigenze di ricerca e sviluppo in biotecnologia e farmacologia.
Sottocategorie di "Peptidi"
Trovati 30315 prodotti di "Peptidi"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
5Fam-GPGPGPGPGPGPGPGPGPGP-OH
<p>Peptide 5Fam-GPGPGPGPGPGPGPGPGPGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPPGFSPFR^-OH
Peptide H-RPPGFSPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-98
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,663 g/molH-IGQLEEQLEQEAK^-OH
<p>Peptide H-IGQLEEQLEQEAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFPGFFSPMLGEFVSETESR^-OH
<p>Peptide H-TFPGFFSPMLGEFVSETESR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-GQVGRQLAIIGDDINR-NH2
Peptide Ac-GQVGRQLAIIGDDINR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLEDVFSK^-OH
<p>Peptide H-HLEDVFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Chorionic Gonadotropin-β (109-145) (human)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C167H264N46O58S1Peso molecolare:3,876.27 g/molH-LLVVYPWTQR^^-OH
<p>Peptide H-LLVVYPWTQR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WMDF-NH2
<p>Peptide H-WMDF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Peso molecolare:606.7 g/molH-VEIIATMK^-OH
<p>Peptide H-VEIIATMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FQTFEGDLK^-OH
<p>Peptide H-FQTFEGDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>[5-FAM]-IFN-γ receptor (pTyr) peptide
<p>Signal transducers and activators of transcription 1 (STAT1) binding peptide. STAT1 is a biotinylated protein that contains an SH2 domain, which binds to specific phospho (pY)-containing peptide motifs. Interferon &γ- (IFN&γ-/type II IFN) activates STAT1 by its phosphorylation. STAT1 is a critical mediator of cytokine signalling and has been reported as a tumour suppressor in breast cancer, myeloma and leukaemia.IFN&γ- is secreted by immune cells and signals through the IFN&γ- receptor and downstream signalling pathways including the janus kinase (JAK)/STAT pathway. IFN&γ- is a central mediator of the adaptive immune system and regulates macrophage activation to promote the expression of high levels of pro-inflammatory cytokines (Il-1β, IL-12, IL-23, and TNF-α)- production of reactive nitrogen and oxygen intermediates- promotion of CD4+ T helper 1 (Th1) cell response and strong inflammatory activity. IFN&γ- inhibits viral replication and is essential for vaccine-mediated immune responses. IFN&γ- signalling is usually short-lived to elicit recovery of homeostasis, including tissue repair, however IFN-&γ- is elevated in severe adult asthma and is present in the airways of children with severe asthma. This indicates a key role for IFN&γ- in inflammatory conditions.Peptide contains a phosphorylated tyrosine residue and an N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag</p>Peso molecolare:1,364.5 g/molH-ALPMHIR^-OH
Peptide H-ALPMHIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LMKNMDPLNDNV-NH2
<p>Peptide Ac-LMKNMDPLNDNV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Rhod-HIPRT-OH
<p>Peptide Rhod-HIPRT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VSFELFADK^-OH
<p>Peptide H-VSFELFADK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ACTH (1-13), human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C75H106N20O19SPeso molecolare:1,623.9 g/molAc-LEGR-OH
<p>Peptide Ac-LEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ETIEIETQVPEK^-OH
<p>Peptide H-ETIEIETQVPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VASLR^-OH
Peptide H-VASLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myr-KRMKVAKNAQ-OH
Peptide Myr-KRMKVAKNAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-RKRCLRRL-OH
<p>Peptide Biot-RKRCLRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H2N-Phe-Ala-Phe-Arg-Asp-Leu-Cys-Ile-Val-COOH
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C51H78N12O12S1Peso molecolare:1,083.3 g/molSuc-Ala-Val-Pro-Phe-pNA
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C32H40N6O9Peso molecolare:652.7 g/molH-YFIDFVAR^-OH
Peptide H-YFIDFVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
<p>Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MYNPTNILDVK^-OH
<p>Peptide H-MYNPTNILDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QPR^GRILGGQE-OH
<p>Peptide H-QPR^GRILGGQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELLETVVNR^-OH
Peptide H-ELLETVVNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VFDEFKPL^VEEPQNL^IK-OH
<p>Peptide H-VFDEFKPL^VEEPQNL^IK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IL^DTAGL^EEY-OH
<p>Peptide H-IL^DTAGL^EEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]-4-methylpentanoyl]am ino]-3-methylbutanoyl]pyrrolidine-2-carbonyl]amino]-4-methylsulfanylbutanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C42H74N10O12SPeso molecolare:943.18 g/molDynorphin A (1-17)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C99H155N31O23Peso molecolare:2,147.5 g/molHXB2 gag NO-46
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,624.8 g/molHXB2 gag NO-26
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,788 g/molH-2Kb Mouse L protein LEYDFNKL
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-NVTGFFQSFK^-OH
<p>Peptide H-NVTGFFQSFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTYIHWVR^-OH
<p>Peptide H-DTYIHWVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Mage-1 Antigen (161-169), human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C41H57N11O17Peso molecolare:975.97 g/molH-YNGIITDTIK^-OH
<p>Peptide H-YNGIITDTIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVAAPSVFIFPPSDEQLK^-OH
<p>Peptide H-TVAAPSVFIFPPSDEQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LASGVPSR^-OH
<p>Peptide H-LASGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVSVLTV^LHQDWLNGK^-OH
<p>Peptide H-VVSVLTV^LHQDWLNGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 21 (YFTGSEVENVSVNVH)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,680.8 g/molHistone H3 (73 - 83)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C58H94N16O20Peso molecolare:1,335.6 g/molAc-CKSGTGIAAMSVMRPEQ-NH2
<p>Peptide Ac-CKSGTGIAAMSVMRPEQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GLP-1 (9-36) amide
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C140H214N36O43Peso molecolare:3,089.44 g/molH-VGNEIQYVALR^-OH
<p>Peptide H-VGNEIQYVALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-FSPDDSAGASALLR-OH
<p>Peptide LCBiot-FSPDDSAGASALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IADFGLAR^-OH
Peptide H-IADFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-QMNQIQSVEV-OH
Peptide Ac-QMNQIQSVEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EQLTPLIK^-OH
<p>Peptide H-EQLTPLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLADELALVDVIEDK^-OH
Peptide H-DLADELALVDVIEDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSYQV^YSK^-OH
<p>Peptide H-TSYQV^YSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PBR
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Ac-EDIIRNIARHLAQVGDSMDR-NH2
Peptide Ac-EDIIRNIARHLAQVGDSMDR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YRPGTVALR^-OH
<p>Peptide H-YRPGTVALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFGSPNR^-OH
<p>Peptide H-SFGSPNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AL^PAPIEK^-OH
<p>Peptide H-AL^PAPIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cy5-KAPAR-OH
<p>Peptide Cy5-KAPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-V^YIHP^F^HL-OH
Peptide H-V^YIHP^F^HL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Human Papillomavirus E7 protein (49 - 57)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C52H77N15O13Peso molecolare:1,120.29 g/molLCBiot-AHGVTSAPDTRPAPGSTAPPA-NH2
Peptide LCBiot-AHGVTSAPDTRPAPGSTAPPA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-HMRSAMSGLHLVKRR-OH
<p>Peptide LCBiot-HMRSAMSGLHLVKRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Lauric Acid-NPSSLFRYLPSD-OH
<p>Peptide Lauric Acid-NPSSLFRYLPSD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLAVTDSPAR^-OH
Peptide H-VLAVTDSPAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.VP1 14-22 (HLA-B*07:02)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolBiot-KKALRRQETVDAL-OH
<p>Peptide Biot-KKALRRQETVDAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Sex pheromone, iCF10
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C40H67N7O9Peso molecolare:790 g/molH-EQLSSVSSFER^-OH
Peptide H-EQLSSVSSFER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Fam-FLPSDCFPSV-OH
Peptide 5Fam-FLPSDCFPSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TIVTTLQDSIR^-OH
<p>Peptide H-TIVTTLQDSIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FAQTVMTSR^-OH
<p>Peptide H-FAQTVMTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CERFLGTSEATKL-OH
<p>Peptide Ac-CERFLGTSEATKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EHSSLAFWK^-OH
<p>Peptide H-EHSSLAFWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-7/aa25 - 39
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,842.3 g/molaiC15-RIIDLLWRVRRPQKPKFVTVWVR-OH
<p>Peptide aiC15-RIIDLLWRVRRPQKPKFVTVWVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ttpa-SGSG-OH
<p>Peptide ttpa-SGSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AQEEAEAEER^-OH
<p>Peptide H-AQEEAEAEER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSIMR^-OH
<p>Peptide H-SSIMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Hrk BH3 amide
<p>A peptide derived from the Hrk (Harakiri) protein, which is a pro-apoptotic member of the BH3-only family within the larger Bcl-2 family of proteins. The BH3 domain of Hrk, contained in the Hrk BH3 peptide, is the critical region responsible for promoting apoptosis by interacting with and neutralizing anti-apoptotic proteins like Bcl-2, Bcl-xL, and Mcl-1.The BH3 domain within the Hrk BH3 peptide binds to anti-apoptotic proteins, disrupting their ability to prevent apoptosis. This releases pro-apoptotic proteins like Bax and Bak, allowing them to oligomerize and permeabilize the mitochondrial outer membrane. This leads to the release of cytochrome c and the activation of downstream caspases, which execute cell death.Hrk specifically targets Bcl-xL and Mcl-1 more efficiently than some other BH3-only proteins, making it a potent inducer of apoptosis in cells where these anti-apoptotic proteins are overexpressed, such as in certain cancer cells.</p>H-ALP^AP^IEK^-OH
<p>Peptide H-ALP^AP^IEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 104
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,697.1 g/molH-ISTLNSHNLPILR^-OH
Peptide H-ISTLNSHNLPILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Trp63,Trp64)-C3a (63-77)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C86H134N26O18Peso molecolare:1,820.17 g/molSIVmac239 - 35
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,621.9 g/molH-GFFYTPK^-OH
<p>Peptide H-GFFYTPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LAQGAYRTAVDLESLASQLT-NH2
<p>Peptide Ac-LAQGAYRTAVDLESLASQLT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-31/aa121 - 135
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,658.8 g/molH-ELAFNLPSR^-OH
<p>Peptide H-ELAFNLPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Proadrenomedullin N-terminal 20 Peptide (Human, 9-20)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C77H119N25O14Peso molecolare:1,618.95 g/molH-GALQNIIPASTGAAK^-OH
<p>Peptide H-GALQNIIPASTGAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GP120 - W61D - 54
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,704.1 g/molH-FITLVPSNLPHEATR^-OH
Peptide H-FITLVPSNLPHEATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-V^IFDANAPVAVR-OH
<p>Peptide H-V^IFDANAPVAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Laminin (925-933)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C40H62N12O14SPeso molecolare:967.1 g/molH-AQDFVQWL^MNT-OH
<p>Peptide H-AQDFVQWL^MNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-114
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,599.7 g/molAc-YSPWTNF-OH
<p>Peptide Ac-YSPWTNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WLSLLVPFV^-OH
Peptide H-WLSLLVPFV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peptide WE-14
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C72H116N18O24SPeso molecolare:1,649.9 g/molFluor-Y-OH
<p>Peptide Fluor-Y-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AMHVAQPAVVLASSR^-OH
<p>Peptide H-AMHVAQPAVVLASSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTIIPQDPILFSGSLR^-OH
Peptide H-LTIIPQDPILFSGSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GILLP^QK-OH
<p>Peptide H-GILLP^QK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Asp-Met-Arg-Pro-Glu-Ile-Trp-Ile-Ala-Gln-Glu-Leu
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C147H225O41N45S1Peso molecolare:3,310.7 g/molH-NTLYLQMNSLR^-OH
<p>Peptide H-NTLYLQMNSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GADGVGKSAL^-OH
Peptide H-GADGVGKSAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CLDSPLPLRQRLKLRFQST-OH
<p>Peptide Ac-CLDSPLPLRQRLKLRFQST-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNIDLLWSV^-OH
Peptide H-LNIDLLWSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myr-FEEERA-OH
<p>Peptide Myr-FEEERA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN gp160 Fragment 10
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:2,261.8 g/molH-TSYQVY^SK^-OH
Peptide H-TSYQVY^SK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-32/aa125 - 139
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,731.9 g/molH-PKCPEPCPPPKCPQPCPP-NH2
Peptide H-PKCPEPCPPPKCPQPCPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-TRPPTLSPIPHIP-NH2
Peptide Biot-TRPPTLSPIPHIP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CKALKSGKIEGEDRK-NH2
<p>Peptide H-CKALKSGKIEGEDRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVEEVSLRK^-OH
Peptide H-AVEEVSLRK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Dabcyl-SFNFPQIT-Edans
Peptide Dabcyl-SFNFPQIT-Edans is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TEGDGV^YTLNDK^-OH
<p>Peptide H-TEGDGV^YTLNDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF^-OH
<p>Peptide H-LQLQPFPQPELPYPQPELPYPQPELPYPQPQPF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DL^AFPGSGEQV^EK-OH
Peptide H-DL^AFPGSGEQV^EK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 19 (NQLQVQHTYFTGSEV)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,750.9 g/molH-GCSFLPDPYQK^-OH
<p>Peptide H-GCSFLPDPYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNVDEVGGEALGR^^-OH
<p>Peptide H-VNVDEVGGEALGR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CYIQNCPLG-NH2
<p>Peptide Ac-CYIQNCPLG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Tum-P35B Peptide (NGPPHSNNFGY)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-DLLDTASALYR^-OH
Peptide H-DLLDTASALYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGGGVSMANAANIPSK^-OH
<p>Peptide H-LGGGVSMANAANIPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Rpr-NH2
<p>Peptide Ac-Rpr-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biotin-LC-BimS BH3 (51-76) acid
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-MGKLSKIWDLPL^DE-OH
<p>Peptide H-MGKLSKIWDLPL^DE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-LRGGAPTK-NH2
Peptide Ac-LRGGAPTK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-43/aa169 - 183
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,563.8 g/molH-NTAYLQMNSL^R-OH
Peptide H-NTAYLQMNSL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CKIQEFHVDGKE-NH2
<p>Peptide Ac-CKIQEFHVDGKE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ENLQFSAAL^R-OH
Peptide H-ENLQFSAAL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ICLDLQAPLYK^-OH
Peptide H-ICLDLQAPLYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CEVRRIDLVKRDYSR-NH2 PAB-405-1419A
Peptide Ac-CEVRRIDLVKRDYSR-NH2 PAB-405-1419A is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SLGR-OH
Peptide Ac-SLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GNPARARERLKNIERIC-NH2
<p>Peptide Ac-GNPARARERLKNIERIC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPDAVATWLKPDPSQK^-OH
<p>Peptide H-YPDAVATWLKPDPSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Angiotensin, Canine, Rat
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C41H62N12O11Peso molecolare:899 g/molAc-CFLSPEELQSLVPLSD-NH2
<p>Peptide Ac-CFLSPEELQSLVPLSD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DGIIWVATEGALNTPK^-OH
<p>Peptide H-DGIIWVATEGALNTPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CMASHLRRSQY-OH
<p>Peptide Ac-CMASHLRRSQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SDGVAGLYR^-OH
Peptide H-SDGVAGLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VYSNFLR^-OH
<p>Peptide H-VYSNFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VFLENVIR^-OH
<p>Peptide H-VFLENVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LETAPNISK^-OH
Peptide H-LETAPNISK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YSDYFKPFSTGK^-OH
<p>Peptide H-YSDYFKPFSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VIFDANAPVAVR^-OH
Peptide H-VIFDANAPVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV - 1 MN ENV - 197
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,976.3 g/molLys-Leu-Val-Val-Val-Gly-Ala-Gly-Gly-Val
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C41H75N11O11Peso molecolare:898.1 g/molLCBiot-HASTNMGLEAIIRKALMGKYDQW-OH
Peptide LCBiot-HASTNMGLEAIIRKALMGKYDQW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IEIYPTSLTK^-OH
Peptide H-IEIYPTSLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 37
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,731.1 g/molSIVmac239 - 12
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,618.8 g/molH-IQIIPK^-OH
<p>Peptide H-IQIIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 31 (LNIPSINVHHYPSAA)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,632.8 g/molH-NAVPITPTLNR^-OH
<p>Peptide H-NAVPITPTLNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PASD1 167-175 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-NIYLNSGLTSTK^-OH
<p>Peptide H-NIYLNSGLTSTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HCMV IE-1 199-207 mutant (HLA-B*08:01) 201K, 205I
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-Gly-Arg-Gly-Asp-Asn-Pro-OH
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C23H38N10O10Peso molecolare:614.6 g/molH-ELINNELSHFLEEIK^-OH
<p>Peptide H-ELINNELSHFLEEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 55
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecolare:1,710.9 g/molH-VLVLDTDYK^-OH
<p>Peptide H-VLVLDTDYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-SPDVDLGDISGINAS-OH
Peptide LCBiot-SPDVDLGDISGINAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DPGVLDR^-OH
Peptide H-DPGVLDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLTSVINQK^-OH
<p>Peptide H-GLTSVINQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSPIYNLVPVK^-OH
Peptide H-LSPIYNLVPVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HHHHHHC-NH2
<p>Peptide H-HHHHHHC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 88 (FFFDIDLLLQRGPQY)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,872.2 g/molH-VHLTP^EEKSAVTAL-OH
Peptide H-VHLTP^EEKSAVTAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVLLNAIYLSAK^-OH
<p>Peptide H-LVLLNAIYLSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-THLAPYSDEL^R-OH
<p>Peptide H-THLAPYSDEL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GNLLINIR^-OH
<p>Peptide H-GNLLINIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FESSAAKLKRKYWWK^NLK^-OH
<p>Peptide H-FESSAAKLKRKYWWK^NLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Human Histatin 2
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C158H211N45O44Peso molecolare:3,444.6 g/molH-VMAPRTLL^-OH
<p>Peptide H-VMAPRTLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Tesamorelin acetate
CAS:<p>Tesamorelin acetate is a synthetic peptide that functions as a growth hormone-releasing hormone (GHRH) analog. It is derived through complex chemical synthesis techniques that mimic the natural GHRH sequences found in the human body. The mode of action of Tesamorelin involves binding to GHRH receptors in the pituitary gland, which stimulates the secretion of growth hormone. This increase in growth hormone levels subsequently enhances insulin-like growth factor-1 (IGF-1) production, leading to various metabolic effects.Tesamorelin acetate is primarily utilized in the medical field for the reduction of excess visceral adipose tissue in patients with HIV-associated lipodystrophy. This condition leads to the abnormal distribution of body fat, posing significant health risks. By modulating the growth hormone axis, Tesamorelin helps in decreasing visceral fat accumulation, thereby improving body composition and metabolic health in affected individuals. It is important to note that the use of Tesamorelin should be carefully monitored within clinical settings to assess efficacy and safety.</p>Formula:C221H366N72O67SPurezza:Min. 98 Area-%Colore e forma:PowderH-TTPPV^LDSDGSFFLYSR^-OH
<p>Peptide H-TTPPV^LDSDGSFFLYSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-I^L^AR-OH
<p>Peptide H-I^L^AR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CMQNPYSRHSSMPRPDY-OH
<p>Peptide Ac-CMQNPYSRHSSMPRPDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLQEYQDLLNVK^-OH
<p>Peptide H-HLQEYQDLLNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>pE-VHHQK-OH
<p>Peptide pE-VHHQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGTTVPESIHSFIGDGLVKPEALNK^-OH
<p>Peptide H-TGTTVPESIHSFIGDGLVKPEALNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFSLSTNLQESLR^-OH
<p>Peptide H-SFSLSTNLQESLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NVPLPVIAELPPK^-OH
Peptide H-NVPLPVIAELPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GIYDGDLK^-OH
<p>Peptide H-GIYDGDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SARS-COV-2 S Protein ( 568 - 577 )
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecolare:1,076.12 g/molH-GVYYPDK^-OH
Peptide H-GVYYPDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WEAAHVAEQLR^-OH
<p>Peptide H-WEAAHVAEQLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(Des-Asp1)-Angiotensin I
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C58H84N16O11Peso molecolare:1,181.42 g/molCathelin-related
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C197H338N56O50Peso molecolare:4,291.1 g/molH-DRVYI^HPFH-OH
<p>Peptide H-DRVYI^HPFH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FIASNGVK^LV-OH
Peptide H-FIASNGVK^LV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ESTLHLVL^-OH
<p>Peptide H-ESTLHLVL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
![[5-FAM]-IFN-γ receptor (pTyr) peptide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1100416.webp&w=3840&q=75)
